Green Library | bangoseguros.es-Page:306

City Of The Snakes.
A Bloody Picnic Tommy Apos S Humour 1914 18.
Lebron James African American Heroes.
The Unofficial Guide To Disneyland 2005.
Case Analysis And Prescribing Techniques 1st Edition.
Oracle Pl Sql Language Pocket Reference.
Intel Threading Building Blocks Outfitting C For Multi Core Processor Parallelism.
Universal Design For Web Applications Web Applications That Reach Everyone.
C 3 0 Design Patterns.
Creativity For Education.
8 Minutes In The Morning To Lean Hips And Thin Thighs Kit.
The Answer Is Simple Oracle Cards.
Messages From Water And The Universe.
Enterprise Development With Flex Best Practices For Ria Developers Adobe Dev Lib.
When Your Baby Wont Stop Crying A Parent Apos S Guide To Colic.
Psycho Kitties.
Nice Girls Do Get The Sale.
81 Challenges Smart Managers Face.
Do You Know Ultimate Trivia Book A Fun Quiz About The Who What When Where Why And How Of A Whol.
You Shouldnt Have To Say Goodbye.
The Killer Book Of Serial Killers Incredible Stories Facts And Trivia From The World Of Serial Kil.
The Best Philadelphia Sports Arguments The 100 Most Controversial Debatable Questions For Die Har.
Pemberley Shades Pride And Prejudice Continues.
Truth Or Dare Sex Coupons.
The Best Ever Ring Bearer All The Best Things About Being In A Wedding.
Cold Rock River 2e.
Large Print Crosswords 4.
Pencil Paper Draw Animals.
Dynamic Learning Dreamweaver Cs3.
Dynamic Learning Photoshop Cs3.
The King With Horse Apos S Ears And Other Irish Folktales.
Wild Tracks A Guide To Nature Apos S Footprints.
Electronic Components A Complete Reference For Project Builders 1st Edition.
Killer Star.
H R The Heart Of Business.
Beyond The Canvas Critical Vision Of An Indian Painter 1st Published.
Problems In Paradise 666 Questions Concerning Christian Faith.
Economic History Of Early Medieval Northern India.
Enabling Agricultural Markets For The Small Indian Farmer.
Japan Apos S Role In South Asia 1st Edition.
Gums Adhesives And Sealants Technology With Formulae And Their Applications.
Indoor Games Rules Skills And Quiz.
Sacred Groves Among Communities The Mahadeo Kolis And The Kunbis Of The Western Ghats 1st Edition.
Rulers Of The Indian Ocean.
A Study Of Religion 2 Vols.
Across Thibet Being A Translation Of De Paris Au Tonkin A Travers Le Tibet Inconnu Quo.
Sri Aurobindo Apos S Savitri An Adventure Of Consciousness 1st Edition.
Critical Studies In Kurral.
A River In Spate A Collection Of Short Stories 1st Edition.
Agricultural Pollution 2 Vols 1st Edition.
A Dorendrajit Singh.
Animal Kingdom Of The World 2 Vols 1st Edition.
Mongols In India Babur And Humayun The First Two Mughal Emperors 1st Edition.
Fast Analytical Techniques For Electrical And Electronic Circuits.
Debt Games Strategic Interaction In International Debt Rescheduling 1st Edition.
Gateway To Successful Careers And Powerful Memory 1st Edition.
Facts And Foundation In Physical Education 1st Edition.
Paradigms Of Authority In The New Testament Women Apos S Perspective.
The Fatehnama Of Guru Gobind Singh 1st Edition.
My Anthropological Journeys 1st Edition.
Diffusion Of Agriculture Innovations In Village India 1st Edition.
Islamic Architecture In India Reprint.
Shri Krishna Arjuna Samvad.
Welding Technology.
Campus Ministry Among Christians Educational Administrators Teachers Students Youth Workers And C.
Communalisation Of Education The Assault On History Press Reportage Editorials And Articles.
You Asked For It.
The Modern Commercial Draftsman An Exhaustive Compendium Dealing With Legal Drafting Of Agreements A.
The Source Of Inspiration.
Guide To Fema 2nd Edition.
The Geographical Dictionary Of Ancient And Mediaeval India 4th Edition.
Objective Mathematics For Iit Engineering Entrance Examinations 1st Edition.
Initia Amharica An Introduction To Spoken Amharic.
Buttons And Bones.
Endangered.
A Spirited Gift.
The First Casualty 1st Edition.
In The Basement Of The Ivory Tower Confessions Of An Accidental Academic Reprint Edition.
Brakes.
Stripped.
The Reunited.
Protector Original Edition.
Myra Love Soulsong Death.
Basics Of Optics.
Business Unusual Championing Corporate Social Responsibility Volume 2 Excerpts From Ceo Forum 200.
Color And Composition For The Creative Q Improve Any Quilt With Easy To Follow Lessons.
Eyewitness To The Past.
After Socialism Land Reform And Social Change In Eastern Europe New Directions In Anthropology.
The Infertility Survival Guide Everything You Need To Know To Cope With The Challenges While Maintai.
German Literature Jewish Critics The Brandeis Symposium Studies In German Literature Linguistics.
Continuing Dilemmas Understanding Social Consciousness 1st Published In India.
Concept Of Riti And Guna In Sanskrit Poetics In Their Historical Development 1st Indian Edition.
Human Rights Of Women 1st Edition.
Mahanirvanatantram Sanskrit Text Transliteration And English Translation With.
Indian Philosophy Of Religion 1st Edition.
Uttar Pradesh Industrial Disputes Act 1947 With Supplement 2006 2001 Edition With Supplement 2003.
Ma Aarif E Mathnavi Vol 1 A Commentary Of The Mathnavi Of Moulana Jalaluddin Rumi R A.
In Code A Mathematical Journey.
Dishonour Of Cheque Law Practice And Procedure.
Handbook Of Reporting And Communication Skills.
Legally Combating Atrocities On Scheduled Castes And Scheduled Tribes 1st Edition.
Bhakta Kavi Gopala Krishna Oriya Poet.
Facets Of Business Management.
Sustainability And Management Of Aquaculture And Fisheries 1st Edition.
Luke Goes To Bat.
The Thinking Parent Apos S Guide To College Admissions The Step By Step Prog.
Pakistan Apos S Policy Towards The Arab Isarel Conflict.
Henry Tilney Apos S Diar.
Uncertainty In American Politics.
Franklin The Autobiography And Other Writings On Politics Economics And Virtue.
Using Ict In The Primary School 1st Edition.
Differentiation For Gifted And Talented Students.
International Environmental Politics.
American Foreign Policy Traditions.
Investigating Entrepreneurial Opportunities A Practical Guide For Due Diligence 1st Edition.
A Reflective Planning Journal For School Leaders With Insights And Tips From Award Winning Principa.
Child Abuse New Directions In Prevention And Treatment Across The Lifespan.
Ecology And Sustainable Development.
Integrating Traditional Healing Practices Into Counseling And Psychotherapy 1st Edition.
Speaking And Listening Through Drama 7 11.
Public Sector Management.
The Journals Of George Eliot.
The Reading Puzzle Phonemic Awareness Grades K 3.
Heterosexuality In Question 1st Edition.
Introducing Islam To Non Muslim.
The True Religion Of God 5th Edition.
Hyperbolic Geometry From A Local Viewpoint.
Primate Communities.
Kant On Beauty And Biology An Interpretation Of The Critique Of Judgment.
Surveys In Geometry And Number Theory Reports On Contemporary Russian Mathematics 1st Edition.
Mammalian Social Learning Comparative And Ecological Perspectives.
Representations And Cohomology Vol 2 Cohomology Of Groups And Modules.
Stress The Brain And Depression.
Physics And Chemistry At Oxide Surfaces.
Story Of Mohammad The Prophet.
Handbook Of British Chronology.
Standard English Serbocroatian Serbocroatian English Dictionary A Dictionary Of Bosnian Croatian.
The Byzantine Lady Ten Portraits 1250 1500.
Getting And Spending American And European Consumer Society In The Twentieth Century.
More Stories From The Arabian Nights.
Green Am.
Cellular Biotechnology.
High Sheriffs Of Yorkshire High Sheriff Of Yorkshire Thomas Gargrave Sir Richard Hutton The Young.
The Moon Earth Apos S Satellite Our Solar System.
Government Of Idaho Political Party Strength In Idaho Secretary Of State Of Idaho Idaho State Cap.
The Antiquities Of Wisconsin As Surveyed And Described.
Films Shot In Chile Quantum Of Solace.
Jewish Life And Thought Among Greeks And Romans.
Toby Keith Country Music Stars.
Garlic And Other Alliums The Lore And The Science.
The Official Handbook And Strategy Guide Freerealms.
Arise My Love Mysticism For A New Era.
Mistwalker Games Lost Odyssey Ash.
Education In Coquitlam High Schools In Coquitlam Middle Schools In Coquitlam School District 43 C.
The Essentials Of Yi Jing.
Praeger Handbook On Understanding And Preventing Workplace Discrimination 2 Vols.
Battles Of The Mexican Revolution Battle Of Ciudad Juarez.
Fc Shakhtar Donetsk Ion Calugaru.
The Glugs Of Gosh.
Chicago Inside Out Map.
From Grammar To Language Skills.
Materials Handbook A Concise Desktop Reference 2nd Edition.
Christian Texts Gospel Of The Hebrews List Of Gospels Christian Classics Ethereal Library Corpus.
Education In Tampa Florida University Of Tampa Hillsborough County Public Schools List Of School.
Island.
Encyclopaedia Of Great Thinkers On Education.
The English Fable Aesop And Literary Culture 1651 1740.
When Teams Work Best 6000 Team Members And Leaders Tell What It Takes To Succeed.
Search And Destroy African American Males In The Criminal Justice System.
The Analysis Of Emission Lines.
International Capital Markets And American Economic Growth 1820 1914.
The Medieval Super Companies A Study Of Peruzzi Company Of Florence.
An Introduction To Maximum Principles And Symmetry In Elliptic Problems.
Pomeron Physics And Qcd.
Reconciliation Of National Income And Expenditure Balanced Estimates Of National Income For The Uni.
Encyclopaedia Of Modern Ugc Curriculum Xith Plan And Grants.
Parallel Scientific Computing In C And Mpi A Seamless Approach To Parallel Algorithms And Their I.
Philosophy Philology And Politics In Eighteenth Century China Li Fu And The Lu Wang School Under.
From Chronicle To Canon The Hermeneutics Of The Spring And Autumn Annals According To Tung Chung Sh.
Advances In Economics And Econometrics Theory And Applications Eighth World Congress.
Reservations For Women 1st Edition.
Mathematical Methods For Engineers And Scientists 1 Complex Analysis Determinants And Matrices 1st.
Foundation Of Mechanical Engineering 3rd Edition.
Change Your Life A Little Book Of Big Ideas.
I Am Christian.
Mathematical Models In Biology.
Simulating Hamiltonian Dynamics.
The Motion Of Bubbles And Drops In Reduced Gravity.
Fundamentals Of Quantum Mechanics For Solid State Electronics And Optics.
Marriage In Tribal Societies Cultural Dynamics And Social Realities.
Public Accountability Designs Dilemmas And Experiences.
N D Basu On Law Of Arbitration And Conciliation The Most Exhaustive Analytical And Critical Commen.
The Analytical Method Of Navya Nyaya.
Footloose Labour Working In India Apos S Informal Economy 1st Published.
Dynamic Stability Of Structures.
Genomics And Genetic Engineering.
Concept Of Curriculum Planning.
Encyclopaedia Of Modern Methods Of Communication 4 Vols.
Empowerment Of Women Through Entrepreneurship.
Engineering Physics 1st Edition Reprint.
Jesus The Sage The Pilgrimage Of Wisdom.
New Teacher Orientation.
In Search Of Pretty Young Black Men A Novel.
Parcells A Biography.
The Wounded Minister Healing From And Preventing Personal Attacks.
Random Walk Intersections Large Deviations And Related Topics.
Simon And Schuster Crossword Puzzle Book 229 The Original Crossword Puzzle Publisher.
Glimpses Of Soliton Theory The Algebra And Geometry Of Nonlinear Pdes.
Thick As Thieves A Brother A Sister A True Story Of Two Turbulent Lives.
Beacon Hill Back Bay And The Building Of Boston Apos S Golden Age.
Assertive Behaviour.
Gods And Heroes An Introduction To Greek Mythology Yesterday Apos S Cl.
Environmental Chemistry For B Sc Final Hons M Sc.
Amazing Tales For Making Men Out Of Boys.
Harcourt California Science Science Content Support Grade 3.
Story Town Twists Turns Level 3 1 Grade 3 Harcourt School Publishers Story Town Florid.
Mean Soup.
The Beak Speaks.
The Wind In The Willows Unabridged Edition.
Framing The Victim Domestic Violence Media And Social Problems.
Bioorganic Chemistry Carbohydrates.
The Savarkar Controversy.
Russian Thinkers 2nd Edition.
Hepatobiliary Malignancy Its Multidisciplinary Management.
Anatomy A Regional Atlas Of The Human Body.
Electromagnetism Theory And Problems Electrodynamics And Plasma Physics.
Nita Mehta A.
Pathogenesis Of Bacterial Infections In Animals 2nd Edition.
Advances In Natural Products Importance In Health And Economy.
Introduction To Child Development.
Interactive Electrocardiography.
Handbook Of Modern Pharmaceutical Analysis.
A Patriot After All 1940 1941.
Christless Christianity The Alternative Gospel Of The American Church.
Serving God Globally Finding Your Place In International Development.
The General Assembly Of The United Nations A Study Of Procedure And Practice.
Colby College A Venture Of Faith.
Picture Perfect A Novel.
Mom Connection Creating Vibrant Relationships In The Midst Of Motherhood.
Horizons In Hermeneutics A Festschrift In Honor Of Anthony C Thiselton.
Civil Service Rifles In The Great War.
Without Tradition 2 Para 1941 1945.
Admiral Of The Blue The Life And Times Of Admiral John Child Purvis 1747 1825.
Cleveland Way.
Joseph Ratzinger In Communio Vol 2 Christology And Anthropology.
Reading The Gospels Wisely A Narrative And Theological Introduction.
Handbook Of Women Biblical Interpreters A Historical And Biographical Guide.
A Journal To Accepting.
A Third Window Natural Life Beyond Newton And Darwin.
Managing To Survive Working Lives In Small Firms.
Key Out Of Time.
Santa Miracles 50 True Stories That Celebrate The Most Magical Time Of The Year.
Religion In The Emergence Of Civilization Atalh Y K As A Case Study.
Moon New England Biking More Than 100 Of The Best Rides For Road Mountain And Cyclocross Biking.
Human Rights In The Twentieth Century.
Defending Baltimore Against Enemy Attack A Boyhood Year During World War Ii.
What Do You Believe.
Operator Algebras And Their Modules An Operator Space Approach.
The Healers A History Of Scottish Medicine.
You Step One He Steps Thousands.
Encyclopedia And Dictionary Of Medicine Nursing And Allied Health.
Harley Davidson Super Glide Performance Portfolio 1971 1981.
The Fighter Literary Essays.
Diving Dolphin.
Managing People And Organizations Peter Drucker Apos S Legacy.
History Of The Choctaw Chickasaw And Natchez Indians.
Holidays Can Be Murder A Charlie Parkery Christmas Mystery.
Off Street Parking.
Moon Spotlight Dubrovnik The Dalmatian Coast.
Swing Shift All Girl Bands Of The 1940s.
Preceptorship For Newly Registered Nurses.
The Golden Sunflower.
The Children Apos S Jewish Holiday Kitchen 70 Ways To Have Fun With Your Kids And Make Your Fami.
Turkey.
Prentice Hall Writing And Grammar Grammer Exercise Grade 11.
International Monetary Law Issues For The New Millennium.
Continuing Education Programme.
Curriculum Development 2005 Towards Learning Without Burden And Quality Of Education An Evaluation.
The Doom Machine.
Fur Traders Trappers And Mountain Men Of The Upper Missouri.
City And Sanctuary Religion And Architecture In The Roman Near East.
More Terrific Tablecloths.
Environmental Impact Of Fertilizer On Soil And Water.
Systems Of Consanguinity And Affinity Of The Human Family.
Mari Sandoz Story Catcher Of The Plains.
Fashion Footwear 1800 1970.
A Dynasty Of Western Outlaws.
Dynamics Of Internal Gravity Waves In The Ocean.
Modernity And Mind Essays On Culture Change Vol 2.
Predicting Health Behaviour.
Using Statistics A Gentle Guide.
Income Volatility And Food Assistance In Ther United States.
Lotus Illustrated Dictionary Of Zoology 1st Edition.
Let Apos S Laugh Mister Smile.
Confronting Love Poems 1st Edition.
Nutrition And Food.
Editing Techniques For Degree P G Diploma Courses In Journalism And Media Communication.
Encyclopaedia Of Jurnalism In 21 Century.
Mathura The Settlement Pattern And Cultural Profile Of An Early Historical City.
Approaching Islam.
Fresh Fictions Folk Tales Plays Novellas From The North East.
India 2005 A Reference Annual.
Jungle Folk Indian Natural History Sketches.
Criminal Breach Of Trust A Comprative Socio Legal Study Of Indian And Islamic Criminal Laws.
Mass Media In India.
Effectiveness Of Mastery Learning An Indian Experience.
Anita Desai Apos S Fire On T.
Vikas Fun With Craft Amusing Assembly Craft.
Mark Twain 4 Vols.
Transforming The Dry Lands The Sadguru Story Of Westen I E Western India.
Why Be Moral.
Tourism And The Resource Management.
Teaching In A Technology Rich Environment.
The Future Of Distance Learning.
Virtual Education And Educational Futures.
Plucked Instruments Of Northen India With Special Reference To Sitar.
Sorghum Genetic Enhancement Research Process Dissemination And Impacts.
Interpretation In Teaching And Learning.
A Z Illustrated Encyclopaedia Of Health Education.
My First Fun Dictionary.
School Letters For All Occasions.
A World History Of Physical And Health Education Ancient Period.
1891 1917 Factories.
Play And Learn Chess With Latest Rules.
Manmohan Singh Ceo India Inc.
Analysis Of Balance Sheet.
Encyclopaedia Of Track And Field With Latest Rules.
Women Security South Asia A Clearing In The Thicket.
Applied Research In Library And Information Science.
Service Tax.
India Struggle For Freedom.
A Z Handbook Of Women Health.
Fisheries Research Planning And Management In Developing Countries.
Tourism Environment And Ecology.
Hitopadesh.
My Little Library Of Early Learning Abc.
How To Coach Kite Flying.
Important Documents On Security And Diplomacy.
Indian Political System And Law.
Institutions And Democratic Governance A Study Of The Election Commission And Electoral Governance.
Encyclopaedia Of Optics.
International Encyclopaedia Of Management Training And Development.
Chemistry Practicals.
Learn Library Classification.
Concrete Abstract Algebra From Numbers To Grobner Bases.
The Yoga And Its Objects 11th Edition.
Gribov Memorial Volume Quarks Hadrons And Strong Interactions Proceedings Of The Memorial Worksh.
Cricket Oddities.
Enciclopedia Del Vino.
The As 400 Programmer Apos S Handbook A Toolbox Of Examples For Every As 400 Programmer.
The Glory Of Heaven Inspiring True Stories And Answers To Common Questions.
Education In India.
Media Education Reprint.
Role Of Microbes In The Management Of Environmental Pollution 1st Edition.
Goa Apos S Foremost Nationalist Jose Inacio Candido De Loyola The Man And His Writings.
Social Justice And Empowerment.
Democracy In Danger Criminality And Corruption In Lok Sabha Elections.
Handbook Of Journalism Style And Substance 2nd Edition.
C Y Chintamani The Unique Administrator And Journalist.
Immunobiology.
Raja Rao An Anthology Of Recent Criticism 1st Edition.
Rise Of Maratha Power In India 1st Edition.
Buddhist Art In India.
Nuclear Diplomacy The Art Of The Deal.
Principles Of Guidance And Counselling.
Women In The Buddhist Legends 1st Edition.
The Path To Enlightenment Svayambhu Stotra 1st Edition.
Trade And Development Report 1999 Fragile Recovery And Risks Trade Finance Ad Growth.
Glimpses Of Sri Lankan Buddhism 1st Edition.
Stalking Terror Land Mines In Peace And In War.
Citizenship Development Western Mores Eastern Values.
The Mahadev Kolis.
Inter Racial Marriages In London.
Management White Collar Relations.
The Marathi Theatre.
President Zakir Husain A Quest For Excellence.
Theory Of Profit.
Vanishing Forests.
The Indian Economic Conference Papers 1979 Savings Behaviour In India.
South Asia Towards Dynamism And Cooperation.
Regional Study Of Industrial Development Of Vidarbha.
Aid To Collaboration A Study In Indo U S Economic Relations.
Groundnut Marketing.
Mediation Concilation And Arbitration.
Agricultural Labour Wages And Living Conditions In Meerut.
Perspectives In Pre School Education.
Robert Frost.
Monarchy In Nepal Imprisonment To Glory Tribhuvan Era In Nepal.
Poems Of Vinda.
Micro Corneal And Soft Contact Lenses Prescribing And Fitting Techniques.
Politics Of Indian Economy.
Through The Indian Looking Glass.
In The City Of Dazzling Distortions Stories 1st Edition.
Science Of Archaeology In India.
Analysis Of Friendship For The Next Millennium.
Encyclopaedia Of Women In Sports.
Wto In The New Millennium Commentary Case Law Legal Texts.
Rural Development In Nagaland.
Handbook Of Higher Education.
Green Politics 1999.
Culture Democracy And Development.
Musikavamsamahakavyam Atulakavikrtam Atulakavi Apos S Musikavam.
China The Middle Way Of The Middle Kingdom.
Ligny Apos S Lake The Race To Solve The Riddles Of A Vanishing Man.
Mariquilla En La Nieve.
Idealism Pragmatism And Feminism The Philosophy Of Ella Lyman Cabot.
Dolled Up To Die A Novel.
Comparative Concepts Profiles Themes And Movements.
Cost Accounting And Cost Control 4th Revised Enlarged.
Bhartrhari The Grammarian 1st Published.
Gleanings Of The Past And The Science Movement In The Diaries Of Drs Mahendralal And Amritalal Sirc.
Ramshankar Ray.
The Craft Of Poe Apos S Tales 1st Edition.
Grassland Techniques And Management 1st Edition.
Integrated Management Of Plant Resources.
Morality And Religion A Critical Study 1st Edition.
Applied Biology.
A Textbook Of Human Rights.
The Psychology Of Reasoning.
She Had Some Horses Poems.
The Neuroscience Of Human Relationships Attachment And The Developing Social Brain Norton Series O.
The Dao Of Neuroscience Combining Eastern And Western Principles For Optimal Therapeutic Change.
Lighthouses Norton Library Of Congress Visual Sourcebooks In Architecture Design Enginee.
A Clockwork Orange Reprint.
Engaging Cinema An Introduction To Film Studies.
The Norton Book Of Science Fiction Norton Book Of.
Palliative Care For The Elderly In India.
Feel Good Bad Factor In Diffrent Sector.
Biopsychosocial Issues In Positive Health.
Higher Education Social Political And Economic Challenges.
Handbook Of Research Methods In Tourism.
The Taliban Cricket Club.
Cost Audit Practice Manual.
Guide To Tax Audit As Amended By Finance Act 2011 6th Edition.
Company Law And Practice 16th Edition.
Encyclopaedia Of Educational Development And Economic Reforms.
2012 Tlvs And Beis Acgih Tlvs And Beis 1st Edition.
Teaching Ethically Challenges And Opportunities.
Bowel Care Digestive Disorders.
God Politics.
Question Bank For Agricultural Competitions Useful For Jrf Srf Net Cet And Phd.
Biodiversity And Insect Pests Key Issues For Sustainable Management.
English Literary Criticism And Indian Poetics Upto 18th Century.
True Stories Of Mystic Places.
Sherlock Holmes Collection 3.
Maximum Maiden The Unauthorised Biography Of Iron Maiden.
The Woody Guthrie Story.
The American Red Cross From Clara Barton To The New Deal.
Vinacular A Wine Lover Apos S A Z.
The Riddle Of The Sands.
Collected Poems Greg Delanty 1986 2006.
The Lipizzaner.
John Dowie A Life In The Round.
Maximum Bon Jovi The Unauthorised Biography Of Bon Jovi.
Believing The Neuroscience Of Fantasies Fears And Convictions.
Grandma And Me At The Flea Los Meros Meros Remateros.
Ecology Technology And Culture Essays In Environmental Philosophy.
Zippo A Dark Futuristic Novel.
This Wheel A.
The Emerald City Of Oz.
Stories That Move Mountains Storytelling And Visual Design For Persuasive Presentations.
Uremic Toxins By Mass Spectrometry 1st Edition.
Nineteenth Century British And American Poetry Second Half.
Banking And Insurance 1st Edition.
Open Access Movement In The Age Of Innovation And Ict 1st Edition.
Approaches To Teaching Shelly Apos S Poetry.
Textbook Of Algae.
Contemporary Issues In Public Accountability And Audit Institute Of Public Auditors Of India New De.
Child Rights In The New Era.
My Body Slide N Hide.
The Cosmic Mountain In Canaan And The Old Testament.
Brand Equity Strategies.
Technology For Facility Managers The Impact Of Cutting Edge Technology On Facility Management.
Love You To Death Season 4 The Unofficial Companion To The Vampire Diaries.
New Beginnings Ten Teachings For Making The Rest Of Your Life The Best Of Your Life.
Starfish Biology And Ecology Of The Asteroidea.
L P Vidyarthi Contribution To The Development Of Anthropology.
The Cost Of Discipleship Meditations During Lent And Holy Week.
Ghostly Tyne And Wear.
Into The Whirlwind A Novel.
Triumvirate Mckim Mead W.
Zen Of Seeing Seeing Drawing As Meditation.
A Mencken Chrestomathy His Own Selection Of His Choicest Writing.
The Best Nest Beginner Books R.
Aliens For Breakfast.
The Little Rabbit Pictureback R.
The Missing Tooth Step Into Reading Step 3.
Mike Mulligan And His Steam Shovel.
Ira Sleeps Over.
The Whingdingdilly.
The Scottish Heather Book.
Towards A Fuller Humanity A Theological Reflection On Christian Understanding On Human Rights.
Problems Of Ancient India 1st Edition.
V N Shukla Apos S Constitution Of India Reprint.
Handbook Of Weaving 1st Indian Edition.
Environment Energy Health Planning For Conservation 1st Edition.
Land Development Banking In India.
Decentralised Planning For Development In India.
Foreign Trade Aid And Development In Nepal.
Foreign Aid And India Apos S Economic Development.
Thrust Sectors In India Apos S Exports 1st Edition.
Management Planning And Policy Making.
Educational Innovations Institutional Profiles And Case Studies 1st Edition.
Meaningful Interaction With Culturally Different Students.
Physics Education 1st Edition.
Caste And Politics In Bihar.
International Images And Structural Balance.
World War Ii Medical Services India 1st Edition.
Accounting And Finance For Managers.
All You Wanted To Know About Meditation.
Human Well Being Socio Economic Indicators A Global Study.
In Search Of Fair Play Street And Working Children Speak About Their Rights.
Kasturba Gandhi The Sage Of Satyagraha 1st Edition.
Indian Beauty Secrets Pamper Your Body And Soul 1st Indian Edition.
Shivaji And The Emergence Of Marathas.
A Stylistic And Semantic Study Of Two Partition Novels 1st Edition.
Banaras Visions Of A Living Ancient Tradition.
The Lion Of Parliament Dr Syama Prasad Mookerjee 1st Edition.
Managing Human Resource Development An Indian Perspective.
Bank Finance To Corporate Sector In India.
Financial Management Of Public Undertakings.
Financing Of Public Enterprises And Public Participation.
Regional Rural Banks And Rural Development.
Company Directors Under Company Law.
Georges Sorel His Thoughts And Works.
Political Science Annual 1998 99 Focus On Political Theory.
Birthday Messages 1955 79 2nd Edition.
Reality Behind Life 1st Edition.
Meditations Creative Visualization And Meditation Exercises To Enrich Your Life.
Teaching And Coaching Tennis.
Managing People Effectively Managerial Experiences 100 Case Studies.
Welfare Choice And Development Essays In Honour Of Professor Amartya Sen.
Administrators Missionaries And A World Turned Upside Down.
Quest For Justice Perspectives On Mission Of Unity.
Chemistry Of Transition Elements.
Molecular Genetics.
Tribal Women Empowerment And Gender Issues 1st Edition.
Research Trends In Modern Botany Morphological Anatomical Embryological And Chemosystematic Studi.
We Have A Baby.
Katie And The Starry Night.
Mammon.
Curtiss P 40 Snub Nosed Kittyhawks And Warhawks.
Haunted Tunbridge Wells.
The Black Rose Book Two In The Seven Stars Trilogy.
Food The Essential A Z Guide.
Gold Coast Madam The Secret Life Of Rose Laws.
Distracted Settlement New South Wales After Bligh From The Journal Of Lieutenant James Finucane 180.
Dog In The Manger.
La Jugueteria Errante Un Misterio Para Gervase Fen.
Global Warming And Climate Change.
Post Modern Literary Theory.
Benefits Management How To Increase The Business Value Of Your It Projects.
Indirect Tax Law Practice June 2009.
Between A Mother And Her Child.
Small Waterplane Area Ships.
Automated Management Of Library Collection.
Family Planning Programme And Beyond Policy And Administration.
Education And Manpower Planning.
Long Term Fiscal Policy And Planning In India.
Housing Laws In India Problems And Remedies Covering Flats And Apartments Promoters Builders And.
Democracy In India.
Wto And The Indian Economy Reprint.
Philosophy Of Wittgenstein India Responses 1st Edition.
Managing Multilingualism In India Political And Linguistics Manifestations 1st Published.
All You Wanted To Know About Dreams.
Eminent Indian English Writers An Assessment 1st Edition.
The Sociology Of International Politics 1st Cosmo Print.
Recent Trends In Diseases Management Of Fruits And Seeds 1st Edition.
World Economic And Social Survey 2000 Trends And Policies In The World Economy.
For The Soul Thought.
Sarup Apos S Dictionary Of Biotechnology.
Problems In Finsler Space.
Wake Up Laughing My Miraculous Life And Sai Baba.
Police Internal Security And Developmental Disorder In India.
Public Administration And The State.
President Apos S Rule In India.
Macro Theories Of Distribution.
Social Change And Violence The Indian Experience.
Tribal Development In India.
Islam And Its Founder Indian Edition.
Secularism And Constitutionality.
Globalization And Nationalism The Changing Balance Of India Apos S Economic.
El Libro De Las Maravillas.
Ravi Likhda Hai.
Raising Hell Ken Russell And The Unmaking Of The Devils.
Panjwa Sahibzada.
Roshnia Da Baghban.
Cinco Madres Cinco Historias 2nd Edition.
Unfinished Lives Reviving The Memories Of Lgbtq Hate Crimes Victims.
Cynic Sage Or Son Of God Recovering The Real Jesus In An Age Of Revisionist Replies.
Why Four Gospels.
London Eyewitness Travel Family Guide Illustrated Edition.
Paradigms Lost Fighting Stigma And The Lessons Learned.
Sarghi.
Battle Story Maiwand 1880.
The Lost Grizzlies A Search For Survivors In The Wilderness Of Colorado.
Pink And Say.
Today Is Monday.
Cuaderno De Ejercicios Para Dormir Bien.
El Hombre Perro.
Gulabi Pagg.
The Rhino Keepers Struggle For Survival.
Panah.
El Tren.
How To Create The Perfect Wife Britain Apos S Most Ineligible Bachelor And His Enlig.
Closing The Gap Lombardi The Packers Dynasty And The Pursuit Of Excellence.
Clinker Boat Building A Guide To Traditional Techniques.
Excel 2010 Business Basics Beyond.
The Insightful Teacher Reflective Strategies To Shape Your Early Childhood Classroom.
Functional Equations And Inequalities In Several Variables.
Tribes Of Assam And Manipur Reprint.
Kashmir The Constitutional Status 1st Edition.
Contemporary Indian Society Part Ii 1st Edition.
Realism And Revelation In Graham Greene 1st Edition.
Automobile Pollution.
In Their Shadows A Collection Of Four Stories.
Story Of The I N A Reprint.
Human Rights Education Conceptual And Pedagogical Aspects 1st Edition.
Basic Structure And Constitutional Amendments Limitations And Justiciability.
Kindle Life Reprint.
Indian Rural Problems.
Frontiers Of Anthropology 1st Edition.
Infrastructure Development Under Economic Reforms 1st Edition.
Naradasmrti Historical Sociological Political And Legal Study 1st Published.
Writings Of Allama Abdullah Yusuf Ali.
Al Hadiyato Linnisa Islamic Laws Regarding Purity For Women 1st Edition.
Library Preservation And Automation 1st Edition.
Dr H S Gour Apos S Law Relating To Theft Robbery And Dacoity Alon.
The Zombie Tarot An Oracle Of The Undead With Deck And Instructions.
Dynamics Of Non Formal Education 1st Edition.
Meditation Simran 1st Reprint.
Living Words Soul Kindlers For The New Millennium Gleanings Form The Works Of Sri Aurobindo And Th.
All In A Stride Reflections Of A Civil Servant 1st Edition.
The Black Book Of Gujarat 1st Edition.
Coaching Successfully Basketball.
Coaching Successfully Weight Training.
Medicine And Life Sciences In India Vol 4 Part 2 Reprint.
The Indian Air Force A Balanced Strategic And Tactical Application.
Islamic Views On Human Rights Viewpoints Of Iranian Scholars 1st Indian Edition.
Food Science And Applications In Indian Cookery 1st Edition.
Good News New Testament With Psalms.
Quotes And Anecdotes An Anthology For Preachers Teachers 7th Print.
Israel In The Old Testament.
Here And Now Living In The Spirit.
New Girl Law Drafting A Future For Cambodia.
Devotion To The Divine Mercy Of God Novena Chaplet.
Mary Star Of The New Millennium Guiding Us To Renewal Reprint.
Southeast Asian American Studies.
The Voice And The Will Subaltern Agency Forms And Motives 1st Edition.
Managing For Value.
On Cleaning Bookshelves 1st Published.
Supreme Court Yearly Digest 2001 With Table Of Overruled Reversed Followed Etc Cases List Of.
Conservation Science 1st Published.
Business Methods And Machinery.
Economic Geography Of India.
Manipur The Jewel Of India 1st Edition.
Information Technology In Higher Education.
Restaurant Management 1st Edition.
The Art Of Commonsense Living 2nd Print.
Rural Women And Grassroot Organisations Expectations And Outcomes.
Staff And Service Management.
Ramacaritamanasa In South Africa 1st Edition.
Rural Economy And Society Study Of South Eastern Rajasthan During The Eighteenth Century.
The Country Of The Sikhs Punjab The Punjab Under The Sikh Rule 1799 Ad To 1849 Ad.
Jane Austen Apos S Heroes And Other Male Characters A Sociological.
Sanjeev Kapoor Apos S Any Time Temptations 2nd R.
Religious Thought In India 1st Edition.
Aquarium Fish Keeping 1st Edition.
A Glossary Of Some Terms Used In Development And Planning.
A Glossary Of Terms In Regional Planning And Development.
Computer Fundamentals And Programming 1st Edition.
A First Course In Programming With C Reprint.
Seducing Pain 1st Edition.
Lord Lawrence And Reconstruction Of India Under The Crown.
Phases Of Indian Civilization A Historical And Cultural Outline.
Child Labour In India 1st Edition.
Women In India An Exhaustive Study 1st Edition.
Punjab Fairs And Festivals.
Birsa Munda And His Movement 1872 1901 A Study Of A Millenarian Movement In Chotanagpur A Centennia.
Conversions And Citizenry Goa Under Portugal 1510 1610 1st Edition.
Sex Education 9th Print.
Current Issues In Modern Education 1st Edition.
Where I Want To Be.
Peace Locomotion.
Leaves.
Sex Over 50.
It Apos S Not About Food End You.
Weather Whys.
Social Development And Planning In Asia 1st Edition.
Psychology Of Reading Role Of Orthographic Features 1st Edition.
Economic Development And Political Democracy The Interaction Of Economics And Politics In Independen.
Taxmann Apos S Natural Justice Judicial Review Amp.
Climate Weather And Crops In India.
Appreciation Programme For Senior Executives On Recent Developments In Rock Mechanics And Tunnelling.
Transformation Of Herbicidal Technology Chemical Based To Ecological Concern 1st Edition.
The Taste Divine Indian Vegetarian Cooking The Natural Way.
Abelardian Semiotics And Other Essays.
Abuse Of Christian Woman In India And Remedy In 12 Biblical Studies On Equality Of Man And Woman 2nd.
Basic Ideas In Educational Psychology 2nd Edition.
Food Processing Biotechnological Applications 1st Edition.
Competitive Advantage Through Knowledge Management 1st Edition.
St Anthony Of Padua A Warm Hearted Saint.
Perspective On Current Affairs 1st Edition.
A Textbook Of Indian Tourism.
Teaching Languages To Young Learners.
New Century Whose Century The Evolution And Interaction Of Technology Economy Polity And Societ.
Development Strategies For Library And Information Science.
Introduction To Computers And Basic Programming 2nd Edition.
Special Functions Selected Articles Proceedings Of The First National Conference Of The Society For.
Sakti Cult In Orissa 1st Published.
Asia And Twice Born Prometheus Historical Epic Revealed 1st Edition.
Renewables Products And Markets.
Hindu Dances.
The Nature Of Living Tradition Distinctive Features Of Indian Parampara 1st Edition.
Managing The Indian State National.
Japanese Street Style 1st Edition.
In The Land Of Jesus A Travelogue.
The Picture Book.
Fractures And Their Complications.
Ocean Life.
The Philosophical Life Twelve Great Thinkers And The Search For Wisdom From Socrates To Nietzsche I.
Correct English Usage.
Economic Developments In India Edi Monthly Update Volume 52 Analysis Reports Policy Documents.
Encyclopaedic Dictionary Of Science.
Into The Heart Of Faith Ten Steps On The Journey.
The Cambridge Companion To Wittgenstein.
Patterns Of Speculation A Study In Observational Econophysics 1st Edition.
In The Wonderland Of Investment For Nris Financial Year 2003 2004 Assessment Year 2004 2005 4th R.
Common Symptoms Effective Remedies 2nd Edition.
History Of Biology.
Corporate Instinct.
Intranets.
Prem Chand Hindi Novelist And Story Writer.
Bharatiya Samskriti Spectrum Of India Apos S Culture 1st Edi.
Bhagavad Gita For 21st Century Way To Add Years To Life And Add Life To Years 1st Edition.
Extraordinary Performances From Ordinary People.
Malavikagnimitra Of Kalidasa Edited With A Complete Translation Into English Notes Critical And E.
United Nations And Indian Mysticism Parallels On Human Rights And Police 1st Edition.
Exploring Spirituality A Step By Step Guide To Finding And Following Your Own Spiritual Path Reprint.
Environmental Perspectives In India 1st Edition.
Ecclesia Divina Or A Selection Of Hymns From The Four Vedas Reprint.
Atomic Structure 1st Edition.
Jurisprudence And Legal Theory 3rd Edition Reprint.
Glossary Of Terms And Expressions In Sales Tax With Supplement.
Sri Shivsahasranamavali Stotram Namavali.
Supreme Court Yearly Digest 2002 With Table Of Overruled Reversed Followed Etc Cases List Of A.
A Text Book Of Marketing Research 1st Edition.
Global Human Growth Model 1st Edition.
Office Organisaton And Management 1st Edition.
Mercantile Law And Indutrial Law 1st Edition.
Kalidas Bhattacharyya 1st Edition.
Handbook Of Libraries And Librarians In India 1st Edition.
Modern Principles Of Athletic Training.
Public Administration In The New Millennium Challenges And Prospects 1st Edition.
Computer Applications In Management Reprint.
The Vedant Philosophy.
Sociology And Unpredictability In The Growth Of Science And Technology.
Current Trends In Industrial And Applied Mathematics.
Food Health And Vitamins.
God And Self Realization A Scientific And Spiritual View 1st Indian Edition.
Management And Utilization Of Bamboo And Rattan In Papua New Guinea.
Physical Education Foundation.
Verbal Forms In The Rgveda 4th Mandala 1st Edition.
Dynamics Of International Relations 1st Edition.
Engineering Graphics Anna University Syllabus 2004 5 5th Edition.
Bharat Apos S Income Tax Act With Departmental Views Containing Gist Of.
The Funny Side Of English A Read N Laugh Manual To The English Language.
Glimpses Of Sikh Religion.
Inflation Accounting Practices In India Apos S Corporate Sector.
Traditional Self Governing Institutions Among The Hill Tribes Of North East India 1st Edition.
Path Integral Methods And Their Applications 1st Indian Reprint.
Congress Muslim League Tussle 1937 40 A Critical Analysis 1st Edition.
Constitutional Safeguards For Scheduled Caste And Scheduled Tribes 1st Edition.
Development Communication And Information Economics In The New Millennium.
When The Vulture Descends.
Yoga Pushpanjali A Treatise On Astrological Combinations 1st Edition.
Money Laundering An Insight Into The Dark World Of Financial Frauds 1st Edition.
An Introduction To Eastern Ways Of Thinking 1st Edition.
Religion And Philosophy For Modern Youth.
Rural Urban Divide Changing Spatial Pattern Of Social Variables 1st Edition.
Transformation Of India As A Knowledge Superpower Strategies For Action 1st Edition.
A Treatise On Hydromechanics.
Abandoned And Betrayed Afghan Refugees Under Unhcr Protection In New Delhi.
Arpan.
Consumer Protection And Redressal Machinery In India 1st Edition.
Tribal Welfare And Development Emerging Role Of Anthropological Explorations 1st Edition.
Principles And Practices Of Therapeutic Massage 1st Edition.
Downfall Of Mughal Empire 1st Edition.
Indigo Dictionary Of Business The Most Comprehensive Authoritative And Up To Date Work Available.
Islamic Aadaab.
Differential Calculus 1st Edition.
The Home And The World.
Bobby Blues.
Tales Of The Poles.
50 Aesop Apos S Fables.
Summary Proceedings Of The First Icrisat Regional Groundnut Meeting For West Africa 13 16 Sep 1988.
Duty Drawback 2003 04.
Panchayati Raj In India Theory And Practice 1st Edition.
How To Really Love Your Husband.
Religions Of The Hindus Essays And Lectures.
Juma Ke Khutbe Collections Of Sacred Congregational Sermons Delivered On Eve Of Fridays And Eidain I.
Presidents Speak To The Nation Republic Day Speeches 1950 2000.
Presidential Addresses On Arab Islamic Studies.
Life And Work Of Muhammad Jalal Ud Din Rumi.
Internet Technologies.
Alternatives In Agriculture Punjab.
Local Environment And Lived Experience The Mountain Women Of Himachal Pradesh 1st Edition.
Secular Gods Blame Hindu Demons The Sangh Parivar Through The Mirror Of Distortion 1st Edition.
Work Education.
Marine Ecosystems 1st Edition.
Contemporary Education 1st Edition.
Asia Pacific Security Globalisation And Development.
Early Brahmanical Cults And Associated Iconography C 400 B C To A D 600.
Mahrattas Sikhs And Southern Sultans Of India Their Fight Against Foreign Power Reprint Edition.
Justice System And Mutinies In British India Reprint Edition.
Akshay Kumar Dutta.
Bankimchandra Chatterjee Bengali Novelist Reprint.
Pandit Atambapu Sharma Manipuri Writer.
A Home At Last.
The Islamic Art Of Persia 1st Published.
Kargil The Tables Turned.
A Simple Guide To Muslim Prayers.
Some Aspects Of Jainism In Eastern India 1st Edition.
The Sikh Gurus And The Sikh Religion 1st Edition.
Nyayabhasyavarttika Of Bharadvaja Uddyotakara Vol 3 1st Edition.
Antiquities Of Northern Tibet Pre Buddhist Archaeological Discoveries On The High Plateau Findings.
Nepal An Exotic Tourist Destination 1st Edition.
Financial Analysis.
The Fiction Of Bharati Mukherjee A Cultural Perspective 1st Edition.
English Vocabulary 1st Edition.
Orient Book Of Quotations.
Writing Effectively.
World Apos S Greatest Puzzles.
More Sherlock Holmes Puzzles 3rd Printing.
Ethics Management 1st Edition.
Medical Geography Of Indian Tribes 1st Edition.
Migration In The Third World 1954 1994 Views And Reviews 1st Edition.
Basics Of Programming And Oops Concept.
Daughters Of The Earth Women And Land In Uttar Pradesh.
Lahore 1947 2nd Edition.
Educational Psychology An Introducation 1st Edition.
Effective Professional Management 1st Edition.
Fundamentals Of Modern Physics.
Information Technology Management In Libraries 1st Edition.
Systems And Practices Of Effective Library.
Distance Education Challenge And Response 1st Edition.
Quality Education 1st Edition.
Mantrasara The Essential Matins.
Construction Innovation And Process Improvement.
Deadly Legacy.
Sediments Morphology And Sedimentary Processes On Continental Shelves Advances In Technologies Res.
Injuries Of Knee And Leg.
Plantwide Control Recent Developments And Applications.
Managing With Plans And Budgets In Health And Social Care.
Ethnic Business Chinese Capitalism In Southeast Asia.
Biology Question Bank.
Training For Leadership 2nd Impression.
Religious Concept Of Sin 1st Edition.
Cognitive Development Of Culturally Deprived Children 1st Edition.
Time And Work.
The Commonsense On The War On Iraq.
Manual Of Laboratory Procedures For Quality Evaluation Of Sorghum And Pearl Millet.
Proceedings Of The International Pearl Millet Workshop 7 11 April 1986 Icrisat Center India.
The Un Common Sense Of Advertising Getting The Basics Rights 3rd Printing.
Socio Economic Development Of Indian Tribes 1st Edition.
Dictionary Of Subject Titles 1st Edition.
Upanished The Real Truth.
Playing Field Measurement Manual.
A Z Illustrated Encyclopaedia Of Science And Technology.
Badminton Skills And Rules.
Art And Architecture Remains In The Western Terai Region Of Nepal.
Defending The Earth A Way Of Life A Handbook For Earthkeeping Reprint.
Penumbra Life Coming Out Of The Shadows A Novel.
Jeroboam Ii The King And Amos The Prophet A Social Scientific Study On The Israelite Society Durin.
Masters Or Stewards A Theological Reflection On Ecology And Environment.
Networking Of Universities Research Institutions And Industry.
Understanding Major Pains Headaches Migraines Arthritis Backbone Pain Angina And A Host Of Abdom.
Marching Ahead With Science Science And Technology In India Since Independence 1st Edition.
The Indian Empire Its People History And Products Indian Vernaculars And Their Literature Pp 325.
Settlements In The Yamuna Hindon Doab An Archaeological Perspective 1st Edition.
A Study Of Hinduism.
Career In Insurance.
Play And Learn Swimming.
Play And Learn Table Tennis.
Supreme Court Minority Educational Institutions Cases T M A Pai Foundation Vs State Of Karnataka.
A Critical History Of The English Muse.
Genetics 1st Edition.
Geometry In Ancient India.
Valuation Of Perquisites Under Income Tax Act.
Advanced Readings In Comparative Government And Politics Issues And Challenges 3 Vols 2nd Revised E.
Alienation An Existentialist Concept.
All India National Congress 4 Vols 1st Edition.
Antiquity To Modernity In Tribal India 4 Vols 1st Edition.
Bank Lending Law And Practice.
Advances In Fish And Wildlife Ecology And Biology Vol 2.
Committees And Commissions In Pre Independence India 1897 1902 Vol 3 1st Edition.
Financial Management Theory Practice.
Economyths How The Science Of Complex Systems Is Transforming Economic Thought Illustrated Edition.
Civil Engineering Project Management.
Dermatology Venereology Pre Pg Test Review.
Hip Hop Nature Boy And Other Poems.
Race Racial Attitudes And Stratification Beliefs.
Who Was Steve Jobs Who Was.
An Introduction To Medicinal Chemistry.
Comprehensive Dermatologic Drug Therapy.
Complete Green Series Bundle The Sage Reference Series On Green Society.
The International Student Apos S Survival Guide How To Get The Most From Studying At.
Ultimate Music Variety Cd.
Maths Made Easy Key Stage 2 Advance.
Blotto Twinks And The Dead Dowager Duchess First Edition.
Biopiracy The Plunder Of Nature And Knowledge Indian Edition.
India Apos S Foreign Policy Nehru To Vajpayee 1st Edition.
Modern Americal Literature.
Phytohormones In Crop Productivity Under Different Environments 1st Edition.
Ethnoarchaeology In Action 1st Published.
Intercultural Communication An Agenda For Developing Countries.
Future Library Technology 1st Edition.
Emerging Issues Of Indian Economic Development 1st Edition.
Pricing Of New Issues In Indian Capital Market.
Effective Personnel Management 1st Edition.
Environment And Agricultural Pollution 1st Edition.
Parties Elections And Mobilisation.
Red Light Area Social Environment Of Sex Workers 1st Edition.
Business Finance.
Cleaner Air And Better Transport Making Informed Choices.
A Tree In My Village.
Islamic World Inter State Relations 1st Edition.
World Conference On Education For All 1st Edition.
Twist Of Truth 1st Edition.
Video Acquisitions And Cataloguing 1st Edition.
Taxation And Corporate Dividend Behaviour In India.
Biochemistry The Practice Portfolio Of Latest Questions.
D P Mishra The Man And His Ideology.
Dangers Of Information Technology Emerging Threats To Individual Privacy 1st Edition.
A Primer Of Literary Criticism 1st Edition.
Praxis Oriented Lent.
Go And Make Disciples 2nd Reprint.
A Guide To Jeremiah 2nd Reprint.
Plights In Prison.
Shelter For All.
Dangerous Drugs Drinks And Tobacco.
Active Society And Behavioural Therapy 1st Edition.
Entrepreneurship Development In India 1st Edition.
Administrative Discretion And Judicial Review 1st Edition.
Selected Doctrines From Indian Philosophy 1st Edition.
A Textbook Of Helminthes.
International Money And Finance An Analysis Of New Global Architecture.
Marketing Channel Management A Customer Centric Approach 14th Printing.
All You Wanted To Know About Diarrhoea.
Essence Of Buddhism A Collection Of World Famous Quotations 1st Edition.
Research Priorities In North East India With Special Reference In Manipur.
Sarup Dictionary Of Difficult Words 1st Edition.
Geography Of A Himalayan Kingdom Bhutan 1st Published.
Guwahati The Gateway To The East.
Play Better Cricket.
Play Better Diving.
Bitter To Better Harvest Post Green Revolution Agricultural And Marketing Strategy For India 1st E.
Population Health Literacy Concept Content And Communication 1st Edition.
Social Development 1st Published.
Working Capital Management A Comparative Study 1st Edition.
Population Education 1st Edition.
Staff Management And Information Work 1st Edition.
A Z Handbook Of Health Education And Sports Muscles Of The Abdomen And Thorax.
Jahangir Apos S India The Remonstrantie Of Francisco Pelsaert Reprint.
Role Of Panchayati Raj Institutions For Rural Development 1st Edition.
Textbook Of Psychology.
Tribes Of Car Nicobar.
Roots Of Confrontation In South Asia.
Education In Information Age 1st Edition.
Role Of Computers In Library Science 1st Edition.
Subject Analysis In Online Cataloging 1st Edition.
Indian Economy Reflections From The First Decade Of Reforms 1st Edition.
Manual Of Laboratory Specimens Chordates.
Information Technology And Total Quality Management.
William Shakespeare King Richard Ii.
Joint Forest Management In Assam.
Philosophical Psychology Of Soul Mechanism Oriental And Occidental Studies 1st Edition.
Rajasthan Apos S Silver Jewellery A Living Legacy 1st Edition.
Orthopaedic Manifestations And Bone Changes In Sickle Cell Haemoglobinopathy.
El Despido Interior En La Pareja Que Nos Ha Ocurrido.
Encyclopaedia Of Cooperative Management 5 Vols.
A Pali Reader With Notes And Glossary Text And Notes Vol 1 2nd Reprint Copenhagen 1901 Edition.
Ancient Indian Heritage Varahamihira Apos S Indi.
Anthropology Of Development Commemoration Volume In The Honour Of Professor I P Singh 1st Edition.
Buddhist Essays I Five Titles.
Encyclopaedic Dictionary Of Marketing 2 Vols 1st Edition.
Encyclopaedic Dictionary Of Religion And Ethics 3 Vols 1st Edition.
Heterosis And Hybrid Seed Production In Agronomic Crops.
Contemporary American Jewish Novel 2 Vols 1st Edition.
Contemporary Sources Of The Mediaeval And Modern History Of Bundelkhand 1531 1857 Panna Records 16.
Census Of Agriculture 2002 Sri Lanka Small Holding Sector Anuradhapura District Preliminary Re.
Demographic And Health Survey Sri Lanka 2000 Preliminary Report 1st Print.
Agricultural Crops And Livestock 1992 93 Colombo District Preliminary Report.
Among My Souvenirs A Novel.
Sometimes There Is No Blood Domestic Violence And Rape In Rural Sri Lanka Report.
Encyclopedia Of Strategic Management.
The English Works Of Raja Rammohan Roy With An English Translation Of Tuhfatul Muwahhiddin 4 Vols.
Weekly Retail Prices Colombo City January 2000 December 2000.
Fury A Novel.
History Of Bagree Rajya Garhbeta With Special Reference To Its Anti British Role From Late 18th C.
Political Orientation Of People In Rural India A Study Of Bihar With Reference To Antecedents And C.
The Socio Cultural World Of Women In Medieval Andhra From 11th To 13th Centuries A D.
Weekly Retail Prices Colombo City January 1995 December 1995.
Census Of Agriculture 2002 Sri Lanka Small Holding Sector Puttalam District Preliminary Report.
Ethnographic Notes On Southern India.
Living Experiences Of Enlightenment.
Geology Of The Country Around Polonnaruwa Reprint.
Defence Expenditure In South Asia An Overview 1st Edition.
Women In The Informal Sector.
Life Under Milk Wood Women Workers In Rubber Plantations An Overview.
Excursions Adventures And Field Sports In Ceylon Its Commercial And Military Importance.
Gender And Society Some Contemporary Issues.
Post Beijing Reflections Women In Sri Lanka 1995 2000 1st Edition.
A Compendium Of Indian Weed Science Research 1950 1981.
The Hybrid Island Culture Crossings And The Invention Of Identity In Sri Lanka.
Fazail E Amaal Vol 1.
Encyclopaedia Of Chemistry.
Encyclopaedia Of Child Care Welfare And Guidance 2 Vols 1st Edition.
History Of The Parsis Including Their Manners Customs Religion And Present Position 2 Vols 1st Ed.
History Of The Rise Of The Mahomedan Power In India Vol 2.
Encyclopaedia Of Computer Software Technology 3 Vols 1st Edition.
Diagnosis And Treatment Of Diseases In Ayurveda Based On Ayurveda Saukhyam Of Todarananda Part 2 Rep.
Encyclopaedia Of Economic Planning And Development 5 Vols 1st Edition.
Dalits In India 2 Vols 1st Edition.
Principles And Perspectives Vol 1.
Cash Crops Vol 6.
French In India And Indian Nationalism 1700 A D 1963 A D Vol 2.
Illustrated Encyclopaedia Of World Knowledge.
Quarterly Report Of The Sri Lanka Labour Force Survey Third Quarter 1999.
Encyclopaedia Of Health And Nutrition.
The Lion Apos S Roar Two Discourses Of The Buddha From The Majjhima Nika.
India Bangladesh Relations Documents 1971 2002 Vol 1.
C W Thamotharampillai Tamil Revivalist The Man Behind The Legend Of Tamil Nationalism An Interna.
Illustrated Dravyaguna Vijnana 5 Vols.
Manual Of Geology 2 Vols Reprint.
Indian Geomorphology.
Agricultural Crops And Livestock 1993 94 Anuradhapura District Preliminary Report.
Economic Geography Of The World.
Indian Writings On Education 1979 To 1986 An Indicator To Indian Educational Journals Grouped By 2.
Modern Technology Of Agro Processing And Agricultural Waste Products 1st Edition.
Indian Philosophy Vol 3 Reprint.
Globalization And The Transformation Of Planetary Rituals In Southern Sri Lanka.
Indian Writings In English Vol 8.
Introducing Buddhism.
Encyclopaedia Of Investment Management 2 Vols 1st Edition.
Effective Collective Bargaining 2 Vols 1st Edition.
Encyclopaedia Of Library And Information Technology For 21st Century 50 Vols 1st Edition.
Kannada Vol 4 1st Published.
Notes On The Great Indian Circus.
Srngaraprakasa.
Environmental Controversies.
Martial Discord In Indian English Novel An Indepth Study Of Major Contemporary Indian Novelists In E.
Osama Bin Laden The Patron Saint Of Terrorism.
Ashab Al Kahf The Stunning Story Of The Sleepers.
Community And Identities Contemporary Discourses On Culture And Politics In India 1st Published.
Agrarian System In Medieval India Land Revenue Arrangements In Sarkar Shahabad Bihar 1734 1790.
2001 Census As Social Document 1st Edition.
Atomic Energy And India Apos S Nuclear Capability.
Designing And Developing Organisations For Tomorrow 1st Published.
Development Administration In An Indian State Guide Book Evolved For Bdo In Orissa.
Environmental Implications Of Farmland Diversification 1st Edition.
Bus Transport In India The Structure Management And Performance Of Road Transport Corporation.
Come Evening Carry Me Away Poetry.
Dynamics Of Public Enterprise Management.
Ecological Problems Of Developing Countries.
An Essay On The Myth Of The Rbhus 1st Edition.
Industrial Exports And Developing Countries India Search For Countervailing Power.
Minority Peoples In The Age Of Nations States.
Psycho Analytic Concept Of Religion.
Regulated Market In A Rural Economy.
Students Teachers And Parents Academic Interaction In Education Setting.
Submerging Villages Problems And Prospects.
Chamba Himalaya Amazing Land Unique Culture 1st Edition.
Marriage Customs Traditions Of The World Reprint.
Sai Baba An Encounter.
The Company Of Nobel Thoughts.
Community Participation In Natural Resource Management 1st Edition.
The Arab Israeli Wars Indian Edition.
Muslim Educational Thought In The Middle Ages.
Raising Additional Resources In The States.
Political Philosophy Of The Sikh Gurus.
Anthropology.
Comparative Politics 2nd Revised Enlarged Edition.
The Plays Of Eugene Oneill A Critical Study.
Iqbal And The English Romantics.
History Of Ancient India Earliest Times To 1200 A D.
Handbook Of International Sources On Reference And Information 1st Edition.
A Classical Dictionary Of India.
Write For Mathematics 2nd Edition.
Outside The Circle A Video Story With Activities To Combat Racism And Prejudice For Young People Ag.
Pragmatism 3 Vol Set.
A Practical Approach To Special Education For Every Teacher The 13 Book Collection.
B E S T Buddies A Comprehensive Training Programme Introducing A Peer Buddy System To Support Stude.
The Secret Princess.
Canyon Of Dreams The Magic And The Music Of Laurel Canyon Illustrated Edition.
Social Work Practice With Children And Families.
Gerard Manley Hopkins.
Human Rights Christians Marxists And Others In Dialogue.
One Light Flash.
English For Primary And Early Years Developing Subject Knowledge 2nd Edition.
Creating Small Scale Social Programs Planning Implementation And Evaluation.
Chip And Dip Lovers Cookbook.
Pero Tafur Travels And Adventures 1435 1439.
Fundamental Concepts Of Inorganic Chemistry Vol 3 2nd Edition.
Writers On Organizations 6th Edition.
Do Arrests And Restraining Orders Work.
Special Educational Needs A Guide For Inclusive Practice.
The Housing Monster.
Quality Improvement In European Public Services Concepts Cases And Commentary.
Applied Cross Cultural Psychology.
Deceptive Communication.
The Upgrade.
The Plural Self Multiplicity In Everyday Life.
Engel The Practice Of Research In Social Work 3 Editon Holosko Pocket Glossary For Commonly.
Literature And The American College.
Assumptions About Human Nature Implications For Researchers And Practitioners.
A World Of Giant Cities The Metropolis Era.
J3 Crucible Of Chaos.
Media Literacy 6th Edition.
The Catholic Milieu.
The New Roget Apos S Thesaurus Student Edition.
Here On Earth.
Poirot Investigates.
Stardust Of Yesterday.
Hanging By A Thread.
Letter From Home 1st Edition.
Odds Against.
Bad Business.
The Shadow Of The Apocalypse.
Delectable Mountains.
Gemini.
Dont Eat This Book Fast Food And The Supersizing Of America.
Mysteria.
Aging Fight It With The Blood Type Diet.
Demon Apos S Delight.
The Oxford New Italian Dictionary.
Big Girls Dont Cry.
Servant The Awakening.
Dave Barry Apos S History Of The Millenn.
Sweet Life.
Sea Witch Children Of The Sea Book 1.
Suite 606.
Mona Lisa Blossoming.
Seduced At Midnight.
Witch Fury.
Bone By Bone.
Eggs Benedict Arnold.
Guilty Until Proven Innocent.
The Lost Throne.
My Stolen Son The Nick Markowitz Story.
Assassin Apos S Heart.
The Judas Child.
World Class Ice Skater.
Under Crescent And Cross The Jews In The Middle Ages.
The Right Talk How Conservatives Transformed The Great Society Into The Economic Society.
Mammals Of North America 2nd Edition.
Hedge Funds An Analytic Perspective.
Lili At Ballet Paperstar Book.
George Washington Apos S Breakfast.
And America Attacked Monster Of Terrorism In 21st Century 1st Edition.
Globalisation And International Finance.
Technological Change In Indian Irrigated Agriculture A Study Of Water Saving Methods 1st Edition.
Tales Of The Sun Or Folklore Of Southern India 1st Edition.
Early Buddhism Reprint London 1908 Edition.
The Inhabitants Of Asia The History Of Existing And Extinct Nations Their Ethnology Manners And C.
Joint Disorders Care In Ayurveda 2nd Edition.
Library Database Management 1st Edition.
Encyclopaedia Of Natural History 6 Vols.
Encyclopaedia Of Information And Library Science 10 Vols 1st Edition.
Tribal Cosmology Myths And World View Vol 4.
Market Regulation And Development.
Women Poverty And Family Survival.
Encyclopaedia Of Animal Diseases 6 Vols 1st Edition.
Encyclopaedia Of Applied Psychology 5 Vols 1st Edition.
Waders In Sri Lanka A Guide To Their Indentification And Study 1st Published.
Graduate Employment In Sri Lanka In The 1990s.
Perspectives On Language In Society Papers In Memory Of Prof Srivastava 2 Vols.
Sacred Songs Of India Vol 7 1st Edition.
Commonsense About Our Environment.
Encyclopaedia Of Environmental Water Pollution 3 Vols Reprint.
Low Volume Roads Construction And Maintenance A Working Manual 1st Edition.
New Directions In Indian Psychology Social Psychology 1st Edition.
Encyclopaedia Of Sports Health And Physical Education.
Political Science Annual 1997 Special Volume On India At 50.
Life Bob Dylan Forever Young.
Recruiting And Training Successful Substitute Teachers Participant Apos S Notebook.
The Legacy Of Longevity Health And Health Care In Later Life.
Angels In Vietnam Two Vietnam Novels From.
Walsh Introduction To Criminology A Text Reader 2 Edition Pratt Key Ideas In Criminology Bu.
False Friends.
Cumulative Student Activity Record Of Clinical Experience For Msc Nursing Program Log Book As Per.
Social Control And Political Order European Perspectives At The End Of The Century.
Knowing Feminisms On Academic Borders Territories And Tribes.
Leadership Theory And Practice 6th Edition.
Courage To Remember.
Jewish Identity In The Postmodern Age.
African American Acculturation Deconstructing Race And Reviving Culture.
Safe And Effective Gynecological Endoscopic Minimal Access Surgery 1st Edition.
Radiology For Undergraduates And General Practitioners 1st Edition.
Review In Oral Pathology With Mcqs 1st Edition.
Bangladesh Us Relations From Cooperation To Partnership 1st Edition.
Training For Agriculture And Rural Development 1997 98.
Civilization Of Love.
Strange But True In Sikhism.
Yoga For Health Curative Powers Of Yogasanas Reprint Edition.
Afghanistan Things Fall Apart A Wordsmiths Compilation 1st Edition.
Indian Poetesses From Vedic To Modern Times 1st Edition.
Acheulian Culture In Peninsular India An Ecological Perspective 1st Published.
The Hunchback Of Notre Dame Reprint.
Man In Indian Tradition Vidyapati Apos S Discourse On Purusa 1st.
Rural Development And Population 1st Edition.
Us National Missile Defense Strategy Policy Documents 1st Edition.
Office Organisation.
The Kingdom Of Afghanistan A Historical Sketch Reprint Bombay 1911 Edition.
Wise And Wonderful The Animal Alphabet Quiz Book.
Mathematics Of Genome Analysis 1st Edition.
Global Terror 1st Edition.
Environment 2001 A Global Challenge.
Indian Books In Print 1991 A Bibliography Of Indian Books Published In English Language.
Encyclopaedia Of Project Management 2 Vols 1st Edition.
India And Tibet Vol 6 1st Edition.
Select Specimens Of The Theatre Of The Hindus Translated From Original Sanskrit Literature 2 Vols R.
Encyclopaedia Of Technical Terms.
History Of Hindu Mathematics 2 Vols.
The Citrakarmasastra Ascribed To Manjusri Being Volume Ii Of Vastuvidyasastra Vol 2 1st Edition.
Portuguese In India 2 Vols 1st Edition.
N D Basu Apos S Criminal Court Handbook Containing Criminal Minor Acts.
1941 1948 Vol 2.
Occidental Daughters Of Mother India 3 Vols 1st Edition.
Sister Nivedita And Pondicherry Mother Vol 3 1st Edition.
Perspectives In Measurement And Evaluation Of Education 5 Vols 1st Edition.
Encyclopaedia Of Animal Physiology 13 Vols 1st Edition.
A Collection Of The Inscriptions On Copper Plates And Stones In The Nellore Districts.
Encyclopaedia Of Value And Moral Education 5 Vols 3rd Edition.
Practice And Research In Literacy 1st Edition.
Encyclopaedia Of Physical Education And Sports Sciences.
Encyclopaedia Of Education And Culture In Free India 25 Vols 1st Edition.
Organic Chemistry Vol 1 1st Edition.
Cuddapah District Gazetteers Vol 1 Reprint Madras 1915 Edition.
Culture Through The Ages Prof B N Puri Felicitation Volume 1st Edition.
Early Hindu India A Dynastic Study And Cultural History Of Early Indian Civilization 3 Vols.
Handbook On Women And Human Rights A Guide For Social Activists 2 Vols.
Economic Development Planning And Policy In India.
Buffalo West Wing.
Waking Nightmare.
The Taking.
Betsy Ross.
The Man Who Disappeared.
Primary And Elementary Education Policy And Programmes Growth And Development Organisation And Manag.
Healing Mind Body And Soul Reprint.
How To Develop Profitable Listening Skills A Handbook For Developing Most Effective And Efficient Li.
The Complete Guide To Modern Essays.
The Sterling Book Of Idioms.
The Sterling Book Of Concise Dictionary Of English For Everyday Use.
Snooker.
A Crafty Session Politician Jokes.
Bottoms Up With Drinking Jokes.
India And East Asia Culture And Society.
Chemistry Objective Type Questions With Answers.
Handbook Of Research Methodology In History.
Public Administration Concepts And Theories.
Sex Expert Guidance From The Sexologist To Help You Spice Up Your Love Life.
Pregnancy.
India On A New Threshold 1st Edition.
Advanced Dictionary Of Journalism 1st Edition.
Mystery Of Death Of Subhash Chandra Bose.
The Rebellious Rani Of Belavadi And Other Stories 1st Edition.
Rediscovering America American Studies In The New Century.
Selected Tales From Arabian Nights Selected From The Original Sixteen Volumes Of The Book Of The Th.
Problems In Physics For Jee Iit And Equivalent Examinations Vol 3.
Semiotica Indica Encyclopaedic Dictionary Of Body Language In Indian Art And Culture 2 Vols 1st Edi.
1937 1996 Dissertations And Theses Vol 2.
The Early History Of Islam 2 Vols In 1.
Encyclopaedic Dictionary Of Genetics And Organic Evolution 3 Vols 1st Edition.
Prakrti The Integral Vision 5 Vols 1st Published In India.
Encyclopaedia Of Women And Development 20 Vols 1st Edition.
Recent Advances In Plant Biology Dr R N Kapil Felicitation Volume.
Selected Works Of Maulana Abul Kalam Azad.
Text And Hindi Translation.
The Complete Works Of William Shakespeare Vol 2 Reprint.
Ourstory Indian Response To Nineteenth Century Literature 3 Vols.
Outlines Of Indian Philology.
Journey To The North Of India Overland From England Through Russia Persia And Afghanistan Vol 1 R.
The Skanda Purana.
Encyclopaedia Of Food Science 3 Vols 1st Edition.
Encyclopaedia Of Teaching Of Economics 3 Vols 1st Edition.
Politics And The People In Search Of Humane India.
Social Transformation In India Essays In Honour Of Professor I P Desai Vol 1 1st Edition.
Social Transformation In India Essays In Honour Of Professor I P Desai Vol 2 1st Edition.
Various Political Parties Small Groups.
Social Transformation In India Professor Madan Lal Sharma Felicitation Volume.
A Miscellany Vol 3.
Encyclopaedia Of The Universe A Popular Work On The Marvels Of The Heavens The Earth Plant Lif.
Patterns Of Decentralised Governance In Rural India.
Encyclopaedic Dictionary Of Biological Sciences 6 Vols Reprint.
The Earth Has No Corners Felicitation Volume On The 70th Birthday Of Dr Karan Singh 1st Published I.
The Narada Purana Part 1 1st Edition.
Phonology And Morphophonemics.
Papers In Language And Linguistics Vol 2.
The Gazetteer Of Bombay City And Island 3 Vols 1st Cosmo Print.
Recent Advances In Plant Pathology.
Personnel Management Theory And Practice.
Proceedings Of The Eleventh National Power Systems Conference Npsc 2000.
Researches In Indian Archaeology Art Architecture Culture And Religion Prof Vijayakanta Mishra.
Socio Economic Profile Of Rural India 4 Vols 1st Edition.
Mandalas 6 7 8 Vol 3 2nd Revised Edition.
Patterns Of Regional Geography An International Perspective 3 Vols.
Sri Ramachandrika Professor Oruganti Ramachandraiya Festschrift Essays On Indian Archaeology His.
Reference Catalogue Of Indian Books In Print In English Vol 2 Author Index With A Directory Of Pu.
Wind Engineering Retrospect And Prospect.
Societal Structure And Social Problems 3 Vols 1st Edition.
Lakshadweep.
Theoretical Perspectives In Education.
Papers In Language And Linguistics Vol 1.
Research In Social Sciences Professor Amreshwar Avasthi Felicitation Volume.
Wondrous Whispers Of Wisdom From Ancient India For Better Life Management In The New Millennium.
The Variegated Plumage Encounters With Indian Philosophy A Commemoration Volume In Honour Of Pandi.
Working Women And Children 6 Vols 1st Edition.
A History Of The Great Revolt 3 Vols Reprint.
Rama In Indian Literature Art And Thought 2 Vols 1st Edition.
Hall Of Fame And Plant Pathology.
World Trade Organisation Text Vol 2.
Rambles And Recollections Of An Indian Official Vol 2 Reprint Westminster 1893 Edition.
Travels In South Eastern Asia Embracing Hindustan Malaya Siam And China With Notices Of Numerous M.
Vishnudharmottara Purana Translated Into English From Original Sanskrit Text 3 Vols 1st Edition.
Visvambhara Probings In Orientology Prof V S Pathak Festschrift.
Western Political Thought From Bentham To Present Day Vol 2.
Trends In Biomembranes And Bioenergetics Vol 1.
Travels In Tartary Thibet And China During The Years 1844 1846 Vol 1 Reprint London 1851 Edition.
World Apos S Greatest Socialist Thinkers 25 Vols 1st Edition.
Trends In Chemical Engineering.
Trends In Chemical Physics Vol 8.
Readings In Financial Management 4 Vols.
Aspects Of Environment And Resource Ecology Of Garhwal.
Structures Of Significations.
The Book Of The Forest Vol 3 Reprint.
Recent Advances In Entomology 10 Vols 1st Edition.
Tribal Languages Of Ladakh.
Readings In The Indian Parliamentary Opposition 2 Vols 1st Edition.
Readings On Information Technology 2 Vols 1st Edition.
Tribes And Tribal Life 3 Vols.
The Later Mughals Vol I 1707 1720 Vol Ii 1719 1739 2 Vols In 1 Reprint.
Trends In Chemical Physics Vol 4.
Women In Contemporary Indian Society 2 Vols.
Its Validity And Its Sources Vol 1 1st Edition.
Canto Ten Chapters 1 To 4 Vol 1 1st Edition.
The Indian Precambrian A Volume In Honour Of Professor Ashit Baran Roy 1st Edition.
The Ancient History Of The World.
Aranya Kanda Kishkindha Kanda Sundara Kanda Vol 2.
World Labour Report 1993 94 Vol 6 7 Reprint.
English Translation Of Adhyaya One With Sanskrit Text Transliteration Word Boundary Anuvrtti Vrt.
Third World Sociology 2 Vols 1st Edition.
Studies In Tribal Rural And Urban Development 2 Vols 1st Edition.
The Standard Cyclopaedia Of Modern Agriculture And Rural Economy 12 Vols 1st Edition.
Top Cops Biographies Of World Apos S Top Policem.
Sumati Sangitabharanam Gems Of Indian Music And Musicology Prof Sumati Mutatkar Felicitation Volu.
Introductory Microbiology.
Essentials Of Tuberculosis In Children 1st Edition.
Understanding Medical Physiology A Textbook For Medical Students.
Perceptional Cartography And District Planning.
Growth Stability And Equity In Agriculture A Quantitative Analysis 1st Edition.
Personality Issues In Assessment And The Projective Inventory Approach 1st Edition.
Private Development Aid In Transition.
Atlas Of The Child In India.
Commercial Geography Of A Metropolitan City Spatial Structure Of Retailing In Bombay 1st Published.
Developmental Migration A Processual Analysis Of Inter State Rural Rural Migration.
Dynamics Of Development In Gujarat 1st Edition.
Geography Of Marketing And Commercial Activities In India Documentation On Research Information Ci.
Geography Of Plants The Uses Of Principal Cultivated Plants On Which The Prosperity Of Nations Is B.
Poverty In Metropolitian Cities.
Regional Perspectives In Agricultural Development A Case Study Of Wheat And Rice In Selected Region.
Residential Pattern Of Suburbs.
Pharmaceutical Biotechnology.
Advanced Learner Apos S Dictionary Of Accounting 1st Edition.
Environmental Pollution And Agriculture.
Development Of Citizenship Habits Among Indigenous People 1st Edition.
Vedanta And Future Of Mankind.
Ten Short Stories By Suresh Joshi English Translation Of Gujarati Short Stories 1st Edition.
Physical Organic Chemistry 1st Edition.
Pioneers In Scientific Discoveries 1st Edition.
Sleep Wakefulness 1st Edition.
Buddhanusmrti A Glossary Of Buddhist Terms 1st Edition.
Cookery Wizard 1st Edition.
Corporate Strategies New Age Weapons For Excellence.
Distance Open Learning Challenges To Developing Countries 1st Published In India.
Relaxation For Health And Success Stress Reducing Techniques For Confidence And Positive Health 2nd.
In The Name Of Child Labour Eradication And Evaluation Programme 1st Edition.
Knowledge Management In Libraries.
Namamala R A Work On Pali Grammar.
Urban Development And Management 1st Edition.
Armageddon The Battler In The Heaven Between Good And Evil And Other Poetic Pearls 1st Edition.
The Cambridge Illustrated History Religions.
Performance Appraisal Of Mutual Funds In India.
Managing Global Competitiveness What Indian Companies Must Do 1st Edition.
The Dancing Biography And Shovana Narayan.
Indian Prime Ministership A Comprehensive Study 1st Edition.
Methods In Biotechnology And Bioengineering For Pharmacy And Other Biosciences 1st Edition.
Elements Of Biblical Ethics.
Ethics On Health Care A Critique.
Global Research On Drainage In Agriculture An Annotated Bibliography 1960 1986.
Television In Kheda A Social Evalution Of Site.
Planning For Forest Resources And Bio Diversity Management Principles Organization And Methodology.
Law And Practice Of Character And Integrity Rolls 2nd Edition.
Central Administrative Tribunal Digest 1995 1996.
Commentaries On Mental Health Act 1987 With Supplement.
How To Become An Immigrant To Canada And The United States Of America.
Immoral Traffic Prevention Act 1956 4th Edition With Supplement.
Swaraj The Problem Of India.
Crime Its Cause And Treatment.
Distribution Of Refinery Products In India.
Cultural And Structural Dimensions Of Family A Study Of Jalari Fishermen.
Faith Possesses Understanding A Suggestion For A New Direction In Retional Theology.
Numbers Their Iconographic Consideration In Buddhist And Hindu Practices 1st Published.
Information Management In Government.
The Loneliness Of A Long Distant Future Dilemmas Of Contemporary Architecture 1st Published.
Indian Defence Yearbook 2002.
Partition And Genocide Manifestation Of Violence In Punjab 1937 1947.
Mathematics Enjoyment For The Millions Second Revised Edition Enlarged With 50 Brain Sharpeners And.
Lifelong Education 1st Edition.
Economics Planning And Public Administration.
Price Levels And Economic Growth.
Studies In Capital Formation Saving And Investment In A Developing Economy.
Philosophy Of Sex.
Salads And Raitas Fiesta.
Legendary Biju The Man And Mission 1st Edition.
Aesthetics Of Indian Folk Dance.
The Malayalese The People Their History And Culture 5 Vols 1st Edition.
Encyclopaedic Dictionary Of Literary Terms 2 Vols 1st Edition.
The Akbar Nama Of Abul L Fazl Translated From The Persian Vol 3.
Total Quality Management 3 Vols.
The Cambridge World History Of Food 2 Vols.
The Masterpiece Library Of Short Stories 20 Vols.
The Treatise On Indian Medicinal Plants Vol 4 Reprint.
Books Viii Ix And X Vol 4 Reprint.
The Selected Novels.
The Witings Of Kwang 3ze Books Xviii Xxxiii The Thai Shang Tractate Of Actions And Their Retributi.
United Nations On Human Rights 2 Vols 1st Edition.
Encyclopaedia Of Political Parties India Pakistan Bangladesh National Regional Local.
India And Her Problems.
Information Technology Applications In Libraries 1st Edition.
Infomedia In Higher Education 1st Edition.
Bharat Apos S Supreme Court On Direct Taxes 1950 1998 With Case Review.
Company Law Digest 1913 1993 With English Cases And Judicial Analysis 2 Vols.
Recent Advances In Medicinal Aromatic And Spice Crops International Conference Held On 28 31 Jan.
Tropical Sketches Or Reminiscences Of An Indian Journalist 2 Vols Reprint London 1855 Edition.
The Paradoxes Of Partition 1937 47 1937 39 Vol 1 1st Edition.
Agricultural Terminology 1st Edition.
Uncommons In The Commons Community Initiated Forest Reourse Management With Botanical Input 1st Pu.
Constitutional Reforms Problems Prospects And Perspectives 2nd Edition.
Seers Deities And Metres In Vedas 1st Edition.
K P Chakravarti Apos S Words And Phrases Under The Constitution Of Indi.
Vedanta Chandamrita Prasthanatrayi Se Cayana The Vedanta Verses An Annotative Anthology Of Th.
Political Thinkers Of The World 2 Vols.
Katha Prize Stories Volume 9.
Treatise On Fera Law And Practice A Commentary On The Foreign Exchange Regulation Act 1973 Wi.
Triratna Heritage Governance And Equity Honble Shri T N Chaturvedi Festschrift 5 Vols 1st Edit.
Financial Management In Development Banks 1st Edition.
Life And Works Of Booker Prize Winners 1st Edition.
Education And Society 1st Edition.
Grassroots Economics The Poverty Of Agricultural Labourers 1st Edition.
Major Constitutions Government And Politics In U K U S A Switzerland And China 2 Vols 1st Editi.
Preschool Education An Intergrated Preschool Curriculum 1st Edition.
A Textbook Of Algae 1st Edition.
Chordate Embryology 1st Edition.
The Tabaqat I Akbari Of Khwajah Nizamuddin Ahmad A History Of India From The Early Musalman Invasion.
The Travels Of Pietro Della Valle In India From The Old English Translation Of 1664 By G Havers.
The Gospel Of Love Glimpses Of Apos Sri Ram.
The Jataka Or Stories Of The Buddha Apos S Former Births Vol 4 Reprint Cambrid.
Manasollasa And Ayurveda 1st Edition.
Commercial Banking 1st Edition.
Srimad Bhagavadgita Rahasya Or Karma Yoga Sastra.
Reference Manual For Ugc Examinations Net Slet Jrf And Other Upsc Competitive Tests Economics 1s.
Mass Communication Theory And Practice In The 21st Century 1st Edition.
International Ecotourism Environmental Rules And Regulations 1st Edition.
Educating The Nation Documents On The Discourse Of National Educational Of India 1880 1920 1st Publ.
Bodhisattva And Sunyata In The Early And Developed Buddhist Traditions 1st Edition.
Yoga Nidra Yogic Trance Theory Practice And Applications 1st Published.
Architecture Of Bhoslas Of Nagpur 2 Vols 1st Edition.
The Sorcerer King And The Great Abortion A.
Himalayan Snow And Glaciers Associated Environmental Problems Progress And Prospects 1st Published.
Problems Of Primary School Drop Outs 1st Edition.
Creativity In Student Teachers.
Educational Philosophic Beliefs 1st Edition.
Methods Of Teaching Educational Technology 1st Edition.
Methods Of Teaching Civics 1st Edition.
Methods Of Teaching Commerce 1st Edition.
Plural Identities And Political Choices Of The Muslim Community.
Forgotten Identities Women Artisans Of Kashmir 1st Edition.
Transformative Organizations A Global Perspective 1st Edition.
Advertising Basics A Resource Guide For Beginners 6th Printing.
Paradigms Of Learning The Total Literacy Campaign In India 1st Published.
Livestock Epigenetics.
Guided Waves In Structures For Shm The Time Domain Spectral Element Method.
Mcqs In Periodontology With Explanation.
All Creation Groans With Pain.
Tiny The Snow Dog Export Edition.
Materials On European Criminal Law.
Quest Intro Level Reading And Writing Ez Test Cd Rom.
Blue Blooded Vamp.
Clinical Microbiology Made Ridiculously Simple 4th Edition.
Mastering Orthopedic Techniques Spine Surgery 1st Edition.
The Ultimate Why Question Why Is There Anything At All Rather Than Nothing Whatsoever.
Sure Success In Bds Iv Year Vol 1.
Nightshade City Book I Of The Nightshadechronicles.
Trucks And Diggers.
Select Works Of Sri Sankaracharya Sanskrit Text And English Tranlation 1st Cosmo Print.
Peasant Movements In Post Colonial India Dynamics Of Mobilization And Identity 1st Edition.
Sociology Of Religion In India 1st Edition.
Reforming Secondary Education 1st Edition.
Bangladesh Road To Sustainable Development People Apos S Voice.
Symbol Script And Writing From Petrogram To Printing And Further 1st Edition.
The Markandeya Puranam Indroduction Sanskrit Text English Translation With Notes And Index Of Verse.
Islamic Architecture Of Deccan With Special Emphasis On Rayalaseema Region 1st Published.
Sociological Foundations Of Education 1st Edition.
Ancient Indian Surgery Based On Susruta Samhita.
The Light Of The Upanisads 1st Edition.
Environmental Approach In Geography Teaching 1st Edition.
Buddhist Philosophy Of Social Activism 1st Edition.
Buddhist Tantricism 1st Edition.
Theory Of Social Leadership 1st Edition.
Vikramorvasiyam Urvashi And Pururavas Global Paperback Edition.
Dhammapadapali And Suttanipata Dhammapadapali Evam Suttanipata Vol 10 Pali Text With English T.
Mother Divine The Supreme Being Meditation On The Vision Of Eternal Presence An Exposition Of Pe.
Gender Related Problems Of Women Women Apos S Empowerment And Panchayati Raj 1st Edition.
Law Of Electricity In India As Amended By The Electricity Laws Amendment Act 1998 Act No 22.
Mitra On Hindu Law 3rd Edition Reprint.
Insights Into The Mongolian Crescent Of India.
The Untouchables Subordination Poverty And The State In Modern India 1st Edition.
Indian Vegetable Culture For Hills And Plains.
Gentlemen Poets In Colonial Bengal Emergent Nationalism And The Orientalist Project 1st Edition.
Keeping The Air Clean The Junior Library Of Ecology.
Tqm In The Service Sector Reprint.
Social Philosophy Of The Mahabharata And Manusmriti.
Breeding In Crop Plants Mutations And In Vitro Mutation Breeding 1st Edition Reprint.
Litchi Botany Production And Utilization 1st Edition.
Seed Science And Technology.
A Gospels Encyclopaedia 1st Edition.
Geriatrics In Ayurveda 1st Edition.
Child Care In Ancient India From The Perspectives Of Developmental Psychology And Paediatrics 1st Ed.
Frontiers In Fungal Biotechnology And Plant Pathogen Relations Proceedings Of The Conference Held F.
At Every Breat A Teaching Stories About The Life And Teaching Of Swami Chinmayananda.
Suravaram Pratapa Reddy Telugu Writer.
Synergising Hrd Interventions Challenges And Initiatives.
A Guide To Educating Children With Learning Disabilities 1st Edition.
Wordoodles Poems.
The Seven Walled Fort And Other Poems 1st Edition.
Existence 2nd Edition.
Paging The Unknown.
Industrial Pollution Technologies For Abatement And Control.
Economic Analysis Of Environmental Problems In Tanneries And Textile Bleaching And Dyeing Units And.
Lal Apos S Commentaries On Water And Air Pollution And Environment Protection Laws Along With.
Three Nes Pas Or Tridosa Vijnana Chapters I To Iv Of Man Nag Rgyud Or Upadesa Tantra Or The Text On.
Selected Works Of Maulana Abul Kalam Azad 1943 46 Vol 2.
Selected Works Of Maulana Abul Kalam Azad Vol 9.
Oriental Numismatic Studies Vol 2 1st Edition.
Origin Development Of Legal A.
Encyclopaedia Of World Women 10 Vols.
Principles And Theory Of Political Science Vol 2.
Encyclopaedia Of The Indian Biography 8 Vols.
The Foundation Of Muslim Nationalism Vol 1.
Small Scale Industries.
Recent Trends In Chordates 6 Vols 1st Edition.
The Farmers Encyclopaedia And Dictionary Of Rural Development.
Socio Economic Survey Of Bhilai Region Part 1.
Rediscovering India India Apos S Philosophy Library 71 Vols.
The Forgotten Monuments Of Orissa Vol 2.
Himachal Pradesh.
South Indian Inscriptions.
Rhymes Through Prayer Praise And Song.
Heteropters.
String Theory.
Samadhipada Vol 1.
Recent Advances In Embryology 5 Vols 1st Edition.
The Masnavi 2 Vols 1st Edition.
Introduction Vol 1 1st Edition.
The New Gresham Encyclopaedia Of The World 12 Vols.
Taxmann Apos S Companies Act As Amendment By Companies.
The Pakistan Gazetteer 7 Vols.
Teaching Tribals Through Gramsevak And Voluntary Agency.
Unknown Soldier And Other Poems 1st Edition.
Our Freedom Struggle 1857 1947 1st Edition.
Coalition Politics The Indian Experience 1st Edition.
Tradition And Transmission Current Trends In French Ethnology The Relevance For India 1st Edition.
Encyclopaedia Of Educational Technology 4 Vols 1st Edition.
Sports Medicine And Management A Practical Approach 2 Vols 1st Edition.
Kevala Bodhi Buddhist And Jaina History Of The Deccan The Bsl Commemorative Volume 2 Vols 1st Edi.
Theories Of Education And Education In The Emerging Indian Society 2 Vols 1st Edition.
The Latest Portfolio Of Theory Practice In Gymnosperm 1st Edition.
Trans Himalaya Discoveries And Adventures In Tibet 3 Vols Indian Edition.
In An Eastern Rose Garden Vol 7 Reprint.
Problems Of Educational Backwardness 1st Edition.
War On Poverty For Taking Poor To Portals Of Civil Life 1st Edition.
Learn To Play On Flute Including Shahnai Been And Piccolo 33rd Edition.
International Dimension Of The Sri Lankan Conflict Threat And Response.
The Indian Annual Register A Digest Of Public Affairs Of India Regarding The Nation.
Orchid Culture In Ceylon And The East Reprint Colombo 1918 Edition.
The Architecture Of Knowledge Quantum Mechanics Neuroscience Computers And Consiousness 1st Editio.
Think Before Getting Grey 1st Edition.
Theory And Applications Of Microeconomics.
The Variation Of Animals And Plants Under Domestication With Illustration 2 Vols.
Pondicherry 1st Published.
Malavikagnimitram Malavika And Agnimitra.
The Story Of My Heart My Autobiography.
Medicinal Plants New Vistas Of Research Vol 1.
The Great Gurus Of The Sikhs 6 Vols 1st Edition.
Educational Technology Knowledge Assessment 1st Edition Reprint.
Rabindranath Tagore Images Of Women Selected Poems 1st Edition.
Sharadatilakatantram Part I Vol 10.
Among The Temples Of China 1st Edition.
Fiction Vol 2 2nd Revised Enlarged Edition.
A Textbook Of Environmental Science 1st Edition.
The Dynamic Geosphere Professor William Sefton Fyfe Felicitation Volume.
The Questions Of King Milinda Vol 2 Reprint.
Advanced Learner Apos S Dictionary Of Information Technology 1st Edi.
The Giant Awakens Punjab Industry And Growth 1st Edition.
The Caraka Samhita 5 Vols 2nd Revised And Enlarged Edition.
Operative Considerations In Ancient Indian Surgery Based On Chapters Samhita Cikitsa Sthana Chapte.
Indigenous Characteristics Of Mughal Architecture 1st Published.
Become A High Achiever.
A Peep Into Yaksagana And Sanskrit Dramaturgy.
Development Of Women An Assessment 1st Edition.
Economic Reforms Sans Development.
How The Brain Got Language The Mirror System Hypothesis.
A Quiet Revolution The Veil.
Formation And Properties Of Clay Polymer Complexes 2nd Illustrated Edition.
Chicano Discourse Socio Historic Perspectives.
The Rational Good A Study In The Logic Of Practice 1st Indian Edition.
Nyayadarsana Of Gotama Text Vatsayayana Commentary And English Translation 8 Vols.
School Organisation 1st Edition.
The Northeast Complexities And Its Determinants 1st Edition.
Psychology Of Learning And Development Development Of Learning And Teaching Learning Process 1st Edi.
Education Polity And Society A Study Of Education And Democratic Consciousness 1st Edition Reprint.
Hindu Nationalism And Democracy 1st Edition Reprint.
Adult Education In India Some Reflections 1st Edition.
Understanding The Social Sphere The Village And Beyond.
India And Australasia History Culture And Society 1st Edition.
Development Gender And Diaspora Context Of Globalisation.
Ancient And Medieval Nepal 1st Paperback Edition.
Brahma Sutras Sanskrit Text English Translation Commentary And Notes 2 Vols 1st Edition.
Methods Of Teaching Computer Science 1st Edition.
Fish Ponds For The Farms Reprint.
Revealing Advaita Vedant 8 Vols 1st Edition.
Investigating Social Capital Comparative Perspectives On Civil Society Participation And Governance.
Arun Joshi Apos S Novels A Critical Study 1st Edition.
Albert Einstein Selected Writings.
Miyazawa Kenji Apos S Ten Japanese Stories For Children 1st Published.
Providing Education For All.
Women In India Retrospect And Prospect.
Tropical Subtropical Fruits And Flowers Cultivation.
Swami Ram The Poet Monk Of The Punjab.
Introduction Vol 1 2nd Revised And Enlarged Edition.
Devyagama Vol 5 2nd Revised And Enlarged Edition.
Ancient Tales Of Wit Wisdom And Humour The Best Of Mulla Nasruddin Tenali Rama Appaji Rao And Ma.
Modern Theories Of Library Cataloguing.
The Other Indians Essays On Pastoralists And Prehistoric Tribal People.
The Problems Of Work.
Genetic Diversity And Food Security.
Motivational Analysis In Music And Dance.
Text Book Of Vector Dynamics 1st Published.
Life Of Buddha.
Tourism And Biodiversity.
Physical Education Fitness And Sports.
Studies In Literature In English Vol 2 1st Edition.
Encyclopaedia Of Modern Educational Technology 3 Vols.
Encyclopaedic Ethnography Of The Himalayan Tribes 4 Vols 1st Edition.
Priyadarsika 1st Edition.
Resource Transfer And Debt Trap.
Principles Of Fruit Preservation 1st Edition.
Encyclopaedic Dictionary Of Economics.
The Indian State After Independence.
Administrative Reforms And Orissa Apos S Development.
The Comptroller And Auditor General Of India An Analytical History 1947 1989.
Ayurveda The Science Of Living Health And Vigour Forever 1st Edition.
Ra Sakyamitra Vol 10 1st Edition.
Pervasive Terms Vyapti Vol 1 2nd Revised Edition.
Role Of Voluntary Organisations In Tribal Development.
Energy Ecology And Environment A Technological Approach 1st Edition.
Agricultural Marketing In India The Case Of Regulated Agricultural Markets In Uttar Pradesh 1998 99.
Azadirachta Indica A Juss Syn Melia Azadirachta Linn Neem Family Meliaceae.
Indian Economy And Socio Economic Transformation Emerging Issues And Problems Essays In Honour Of.
Carbon And Carbon Materials Recent Trends Indo Carbon 2003 Conference Proceedings 1st Edition.
Information Technology In Libraries 1st Edition.
Agriculture And Wto Opportunity For India 1st Edition.
Beekeeping For Profit And Pleasure Indian Reprint.
Indian Constitution.
Solomon Apos S Saga Of A Wild Life Sanctuary Veerangana Durgavati Ab.
Gendered Realities Human Spaces The Writing Of Shashi Deshpande 1st Edition.
A Killer In Kailash 1st Published.
Blue Gold The Fight To Stop The Corporate Theft Of The World Apos S Water Reprint.
The Beginner Apos S Cook Book Eggs 1st Edition.
Conservation Displacement And Deprivation Maldhari Of Gir Forest Of Gujarat.
Century Of Light Bahai World Centre 2nd Edition.
Indian Diaspora In Asian And Pacific Regions Culture People Interactions 1st Edition.
Death.
E Governance A Choice To Upgrade India Apos S Rural Economy.
Electronic Principles Applications And Devices.
Dictionary Of Alternative Meaning.
Dictionary Of Idoms I E Idioms And Pharases I E Phrases 1st Edition.
Emotional Freedom Techniques Revised Edition Reprint.
Crimes In Cyber Space Scams And Frauds Issues And Remedies.
Manuring For Higher Crop Production Reprint.
Diagnostic Radiology And Imaging.
Loricata Testudines Vol 1 2nd Edition.
Sauria Vol 2 2nd Edition.
Everyday Entrepreneurs The Harbingers Of Prosperity And The Creators Of Jobs.
Sucheta Kripalani Great Women Of Modern India.
Feeling The Philosophy Of Bhagavad Gita 1st Edition.
Feminism In India Issues In Contemporary Indian Feminism 1st Edition.
India Apos S National Security Annual Review 20.
Distance Learning Technologies In Education 1st Edition.
10 Essential Foods A Sensible Good Humored Approach To Vitality Health And Well Being Reprint.
History Of Anthropology Revised Edition.
Folk Dances Of Chamba Where Every Talk Is A Apos Song And E.
Library And Information Profession In India Dr P S G Kumar Festschrift.
International Finance And Global Macroeconomics.
International Mediation In The Inter Ethnic Conflict In Eastern Europe 1st Edition.
Selected Punjabi Short Stories 1st Edition.
Indian Democracy And Governance Essays In Honour Of Professor R N Pal 1st Edition.
Recent Trends In Manufacturing Cartm 2003 November 14 15 2003.
Re Engineering Library And Information Services Process People And Technology.
Gandhian Alternative To Contemporary Problems 1st Edition.
Resources Management For Sustainable Development 1st Edition.
Road To Brand Equity 1st Edition.
Gita Today 1st Edition.
Sahni Apos S Hindi English Dictionary With Illustrations Hindi Angreji Sabdakosa.
Differing Interpretations Of The Torah In Matthew Apos S Gospel A Narrative Crit.
Hospital Supportive Services Hospital Administration In The 21st Century 1st Edition.
Integrated Child Development Services A Study Of Job Performance Of Supervisors.
Morphogenesis.
Prehistoric Life 1st Edition.
Foreign Trade And The World Trade Organisation 1st Edition.
Economics Of Tourism And Development 1st Edition.
Information Management.
Health Education 1st Edition.
India Book Of The Year 2004 Events Of December 2002 To November 2003.
Security And Diplomacy Essential Documents 1st Edition.
Science Of Hypnosis 2nd Reprint.
Sitar And Its Compositions 1st Edition.
Shamsur Rahman A Witness Of His Times 2nd Edition.
Sins Of My Youth.
Disparities In Ict Access And Use.
Evolution Of Information And Communication Technologies.
Smoking Cigarettes The Unfiltered Truth Understanding Why And How To Quit.
Some Aspects Of Agricultural Credit In A Developing Economy 1st Edition.
Spiritual Culture Of India And Other Essays 1st Edition.
The Political And Statistical History Of Gujarat Translated From The Persian Of Ali Mohammed Khan.
Paediatric And Gynaecological Considerations And Aphorisms In Ancient Indian Surgery Based On Chapte.
Desert In Bloom Contemporary Indian Women Apos S Fiction In English 1st Edition.
Taxmann Apos S Master Guide To Income Tax Act With Commentary On.
Harvest Of Hatred The Concerned Citizens Tribunal Report On Gujarat 2002.
Hercolubus Or Red Planet 1st Indian Edition.
Inscriptions Of The Vijayanagara Rulers Inscriptions Of The Rulers Of The Sangama Dynasty 1336 A D.
The Potato Production And Utilization In Sub Tropics.
The Quality Assurance Manual.
Jainism And Indian Civilization 1st Published.
The New Wine Skins The Story Of The Indigenous Missions In Coastal Andhra Pradesh India.
Judicial Activism And Accountability.
Kamalahasan The Consummate Actor.
Trade Union As A Social Institution Of Change Korea.
Traditional Exports Of India Performance And Prospects.
Spirituality.
A Z Of Law In Management 1st Edition.
Textbook Of Information Technology 1st Edition.
Local Government Rural And Urban For Ugc Net M A Upsc And State Public Service Commission Exam.
Terrorism In South Asia Views From India 1st Edition.
Mainstreaming Micro Finance.
Women In India Problems And Prospects.
World Trade And Development Report 2003 Cancun And Beyond.
The Primacy Of The Political.
The Private Lives Of World Famous People.
End Of Life Issues.
Nuri Granth The Sacred Songs Of Sadhu T L Vaswani Nuri.
Islam And Peace In The 21st Century.
The Science Of Infant Feeding.
Modern Dictionary Of Eco Environment.
Modern Teaching Of History Strictly According To The Ugc Syllabus For B Ed Course.
Money Banking And Public Finance Based On Ugc Model Curriculum 2002 For B A Pass Hons Econom.
Performance Banking And Rural Development.
Mother Goddesses In Kathmandu.
Jammu And Kashmir.
Ritual And The Quest For Truth.
Poverty Among Scheduled Castes A Study.
Manusmrti With The Sanskrit Commentary Manvartha Muktavati Of Kulluka Bhatta.
Principles Of Teaching In Elementary Schools.
The Archaeology Of Middle Ganga Plain New Perspectives Excavations At Agiabir 1st Edition.
Transition Towards Sustainable Development In South Asia.
Terror On The High Seas 1st Edition.
Law Of Contempt Of Court In India.
Feminine Sensibility In The Novels Of Margaret Drabble An Interpretation And Evaluation.
Letters For All Occasions.
Hand Book On Ayurvedic Medicines With Formulae Processes And Their Uses.
Hand Book On Spices.
Indian Estuaries.
Babur The Tiger.
War In Iraq And New World Order.
Decision Support System.
Issues In Digital Cataloguing.
Existential Authenticity An Examination.
Miracles In Our Bodies.
Handbook Of Environment.
Participatory Learning Action.
Recent Trends In Power Management.
Social Security In A Developing World Context.
The Trodden Path Essays On Regional And Micro Level Planning.
Women And Child Education 1st Edition.
Tourism Strategies For Rural Development.
Winning Amidst Unexpected Unknowns.
Managing Information Knowledge And Power In The Cyber Age Essays In Honour Of Prof R G Prasher.
Memoirs Of My Indonesian Lecture Tour.
India In Sri Lanka Between Lion And The Tigers.
I Am Sorry Ias Indian Bureaucracy At Crossroads.
Experimental Psychology With Advanced Experiments.
North East India Assam Manipur Tripura Nagaland.
Healthcare And Nursing Family.
Anarchism A Political Reader.
Global Justice Liberation And Socialism.
Guide For Obesity Diabetes Hypertension And Other Cardiac Problems.
My Amazing India Daybook.
New World Economy Changing Dimensions Of Commerce Clause Internet As Instrumentality Of Commerce.
Tax Incentives And Economic Growth An International Comparison Uk Usa France Japan Singapore.
The Novels Of Rohinton Mistry A Critical Study.
British Lions And Indian Tigers.
Anthelmintics And Antimycotics.
Heterocyclic Chemistry.
Educational Environment A Key To Effective Teaching.
Daughter Of The Mountains.
Handbook Of Alternative Therapies.
Hinduism Rediscovering The Mystical.
Recent Advances In Natural Language Processing Proceedings Of The International Conference On Natur.
History And Organisation Of Indian Police.
Cops Code Of Conduct.
Contemporary South Asia.
Manpower Profile India Yearbook 2003.
Teachings Of Mahabharata.
Spices Vol 1 Traditional Uses Amp.
The Curse Of The Goddess 1st Published.
Inquiry Into The Nature Of Moral Principles.
Plates Xv Clxiv.
Laws Relating To Cooperative Societies A Commentary.
Southeast Asian Crisis An Economic Analysis.
A Textbook Of Special Education.
Experimental Biotechnology.
A Textbook Of Teacher Education.
Love Management.
Advances In Horticulture And Forestry Volume 2 1992.
Narrative Construction Of India Forster Nehru And Rushdie.
Layout And Marking In Track And Field.
State Of The Indian Farmer A Millennium Study 27 Vols 1st Edition.
Teaching Of Mathematics New Trends And Innovations.
Teaching Of Economics New Trends And Innovations.
A Symposium On Fish Culture A Practical And Comprehensive Guide On Inland Fish Farming.
Development Of Destitute Tribal Communities.
Historiography And Historians Of Modern India.
Analysis Of Milk And Its Products A Lab Manual 2nd Edition.
Abridged Version.
Rural Development And Education.
India And Saarc Engagements.
Dimensions Of Women Exploitation.
Child Counselling And Education.
Role Of Ngos In Development Of Social System.
Encyclopaedia Of Ecology Environment And Pollution Documents And Case Studies.
Sufism In India.
Hatha Yoga Its Context Theory And Practice 1st Edition.
Voyages And Travels Into Brazil And The East Indies Containing An Exact Description Of The Dutch Br.
Democratic Administration And Education.
Foundations Of External Quality Assurance In Indian Higher Education.
New Assignment In Journalism.
The Marcandeya Purana In The Original Sanskrit.
Horticultural Development In Hills A Case For The Alaknanda Basin Uttaranchal.
Dalit Racism And Social Articulation.
Minorities And Social Conflict.
Indian Constitution Government And Politics.
The Voyage Of Francois Pyrard Of Laval To The East Indies The Maladives The Moluccas And Brazil 2 V.
In The Wonderland Of Investment Assessment Year 2004 2005.
The Banishment Of Seeta.
Scenario Of Agriculture In Andhra Pradesh.
Saga Of Energy Mind And Numerology.
State Politics And Panchayats In India.
Bangladesh Army And Contemporary Issues.
Bangladesh Society And Change.
Intellectuals And Society A Study Of Teachers In India.
The Upasana Cintamani Wish Yielding Gem Of Meditation.
Know Your India.
Rural Development In India Approaches And Applications.
Mutual Funds In India.
Communication And Education For Health Promotion And Population Regulation A Global Perspective.
Increasing Role Of Technology In Education.
Politicisation Of Indian Education.
Multicultural Education.
The Power Of Innovative Thinking Let New Ideas Lead You To Success.
India Apos S Elderly A Multidisciplinary Dimension.
India Related Naipaul A Study In Art.
Maratha Military Systems.
Problems Of Research In Public Administration.
Rural Development Through Cooperatives.
Role Conflict Among Women Teachers.
Indian Military Legal Systems.
Textbook Of Inorganic Chemistry.
Sustainable Rural Development For Disaster Mitigation.
Women Empowerment And Gender Planning.
Economic Environment Of Business.
Elementary Education In 21st Century.
Diplomatic Journey Emerging India.
Dictionary Of Common English.
Discover India.
Music Information Retrieval.
Tribal Villages In Arunachal Pradesh Changing Human Interface.
Great Sufi Saints Sarmad And Bawa Muhaiyaddeen.
Cosmo Dictionary Of Mathematics.
The Place Of Aphorisms Vol 1 2nd Revised And Enlarged Edition.
Abdul Hameed Ansari Revolutionary Journalist And Freedom Fighter.
Environmental Crisis And Techno Economic Alternatives.
Indian Kavya Literature.
Changing Trends In Strategic Management.
Economics Of Floriculture.
Globalisation Or Colonisation.
Factions In Northern Rural India.
The Failure Of Lord Cuzon A Study In Imperialism A.
The Clash Of Ideologies Middle Eastern Politics And American Security.
Archbold Criminal Pleading Evidence And Practice 2012 60th Edition Full Print Supplements.
The Works Of Alain Locke.
The Oxford Handbook Of Thomas Middleton.
A Tale Of Things Timeless.
Political Alienation In Libya Assessing Citizens Political Attitude And Behaviour.
Eve Templar 1.
Thief Of Shadows.
God With Us.
To The Last Breath A Memoir Of Going To Extremes Illustrated Edition.
Shakespeare In America.
On Oligarchy Ancient Lessons For Global Politics.
Breaking Ice For Arctic Oil The Epic Voyage Of The Ss Manhattan Through The Northwest Passage.
Polanski And Perception The Psychology Of Seeing And The Cinema Of Roman Polanski.
The Emotional Wellness Way To Cardiac Health How Letting Go Of Depression Anxiety.
Getting Children Back To School Case Studies In Primary Education 1st Edition.
The Invincible Deadly Mosquitoes.
Jaina Worship And Rituals Ancient And Medieval India.
Governance In India A Theatre Of The Absurd.
Indian Constitution Government And Political System.
Organic Compounds.
Organic Synthesis.
Vision Of Raja Rammohun Roy Secularism Humanism Universalism.
Water And Waste Water Management.
Indian Ocean Rim Association For Regional Cooperation Problems And Prospects 1st Edition.
Environmental Security Concept And Dimensions.
Administration And Management Of Ngos Text And Case Studies.
Management Of State Tourism Development Corporations.
Moulds Design And Processing Hand Book The Book Covers Complete Details Of Mould Design And Processi.
Guide To Wellness And Well Being.
Paint Varnish Solvents And Coating Technology 2nd Edition.
Hand Book Of Adhesives With Their Formulaes With Directory Of Manufacturers Suppliers Of Plant Eq.
A Personal Narrative Of A Visit To Ghuzni Kabul And Afghanistan And Of A Residence At The Court.
Caste System In India.
Evaluation Of Educational Research.
Studies In Women Writers In English.
Mental Retardation And Social Responsibility.
Migration And Migrants.
Career Information And Guidance And Counselling.
Diseases Of Crop Plants.
Complete Book On Pregnancy And Child Birth.
Modern Trends In Indian Education 2nd Revised And Enlarged Edition.
Cricket The Essentials Of The Game.
History And Theory Of Public Administration.
War Of Liberation In Bangladesh 1st Edition.
Hillary Rodham Clinton Polarizing First Lady Modern First Ladies.
The Arthur Of The English The Arthurian Legend In English Life And Literature University Of Wales.
On Loving Our Enemies Essays In Moral Psychology.
The Laundry Man.
The Rehearsal Pigeon Theatres Trilogy Of Performance Works On Playing Dead.
Historical Environmental Variation In Conservation And Natural Resource Management.
The Intellectual And His People Vol 2 Staging The People.
God Without Being Hors Texte.
A Cultural History Of Heredity.
The Rhyming Rabbit 1.
Perspectives Of Hotel Management 1st Edition.
2010 Ieee International Symposium On Precision Clock Synchronization For Measurement Control And C.
Islamic Food With Healing Touch.
2010 Ieee 18th International Workshop On Quality Of Service Iwqos 2010 Proceedings Of A Meeting H.
Black Stars African American Women Scientists And Inventors.
2010 3rd International Symposium On Systems And Control In Aeronautics And Astronautics Isscaa 201.
13th International Conference On Aluminum Alloys Icaa 13.
Management Text And Cases 2nd Edition.
Aieee Mathematics As Per New Pattern Of Examinations.
Covent Garden The Fruit Vegetable And Flower Markets.
Play Guitar With Black Sabbath.
Ecotoxicology And Environmental Health.
The Handbook Of Global Health Communication.
Naxalism At A Glance.
The Art Of Mythical Composition And Narration Dagara White Bagr.
Direct Taxes Ready Reckoner With Tax Planning For A Y 2012 2013 2013 2014.
Charity And Philanthropy For Dummies.
Dynamic Memory Modern Paragraph Writing Secondary Level.
Unspeakable Anecdotes My Life Judiciary And More.
The Engineering Train.
Tissue And Cell Clinical Use An Essential Guide.
Contemporary Quilts Design Surface And Stitch.
Encyclopaedia Of Comparative Government And Select Constitutions 3 Vols.
Asymmetric Synthesis Of Natural Products.
History Of Economic Thought.
Household And Family Religion In Antiquity.
The Rise Of Kundalini A Practical Adviser.
An Introduction To Distance Measurement In Astronomy.
Japa And Dhyana In A Nutshell.
Palliative And End Of Life Care For Children And Young People Home Hospice Hospital.
Improving Agricultural Education Concept And Methods.
The Rise Of Middle Classes In Manipur.
Money And Banking In India.
Organizational Behaviour And Design.
Pentacles One Long Short Story And Four Long Story Poems In Free Verse.
Writing Politics Left Discourses In Contemporary India 1st Reprint.
Uttara Kanda Vol 4.
Studies In Occultism 1st Indian Edition.
Rgveda Hymns And Ancient Thought Vol 1 1st Published.
Punjab Today.
Stories From Bhaagavatham 1st Edition.
Understanding Communication Skills.
Regulation Of Financial Intermediaries In Emerging Markets.
Productivity Techniques An Insight Into Flow Manufacturing.
Teacher Commitment.
Test And Measurement In Education.
Death Penalty.
Teaching Of Political Science.
Role Multiplicity Of Lower Middle Class Working Women.
Environmental Degradation Of Jammu And Kashmir Himalayas And Their Control.
Regional Movements Ethnicity And Politics.
Brahmasutram Srimadbrahmasutratadbhasyasahitayamtattvaprakasikayam.
Encyclopaedic Dictionary Of Biology.
Environmental Issues And Challenges.
Environment Protection And Development Emerging Issues Reforms And Strategies.
Old Maps And New Legacies Of The Partition A Pakistan Diary.
Psycho Social Aspects Of Sports.
Teaching Of Physical Science.
History Of Modern China And Japan 1840 1950.
Young Designers 2002.
A Text Book Of Swasthavritta.
Dictionary Of New Words.
Italian Renaissance Painting Colour Library.
Classic Art An Introduction To The Italian Renaissance.
Gothic Revival Art And Ideas.
Monet Art And Ideas.
Christian Boltanski.
Van Gogh Apos S Flowers.
Emerging Religious Identities Of Arunachal Pradesh A Study Of Nyishi Tribe.
Critical Theory Perspectives From Asia.
History Of Dalits.
The Earl Of Auckland And The First Afghan War.
International Encyclopaedia Of School Education.
History Of Journalism For Pg Diploma And Degree Courses In Journalism And Mass Media.
Empowering Of Rural Workers Dynamics Of Strategic Interventions Experiments And Outcomes.
Gender Dynamics In Water Security A Study In Rajasthan.
Computer System Development.
Documents.
India And Her Neighbourhood A French Observer Am.
Kirwant.
Encyclopedia Of Science Projects.
Comparative Politics A Critique.
Mensa Guide To Chess 30 Days To Great Chess.
Research Methodology Modified Syllabus Of Indian Universities B Ed Training Institutes And College.
Islam Apos S Big No To Terrorism Friendship With All Malice For None.
Medherb Green Pages India And Pakistan 2005 A Handbook Of Authentic Updated Information On Indi.
Assam Medieval And Modem History.
The Warrior And The Charioteer A Materialist Interpretation Of The Bhagavadgita Including A New Tra.
Academic Library System.
Nuclear Power And Non Proliferation Conflict Or Convergence.
Sriramacaritabdhiratna Of Nityananda Shastri.
The Strawberry.
The Vakataka Heritage Indian Culture At The Crossroads.
Pakistan Nation Nationalism And The State.
Administration And Training Of Educational And Vocational Guidance.
Dimensions Of Social Research.
British Reforms Conquests And Expansion 1807 1857.
Pakistan Apos S Foreign Policy.
Stopped In Our Tracks Stories Of U G In India.
The Complete Technology Book On Pulp And Paper Industries.
Academic Dictionary Of Electronics.
Academic Dictionary Of Philosophy.
Scientific Methods.
Indian Political System Structures Policy Development.
The Masnavi.
An Essence Of Biotechnology.
Academic Dictionary Of Science.
Public Relations In India 1st Edition.
Encyclopaedia Of Geomorphology.
Physics Of Semiconductors 29th International Conference On The Physics Of Semiconductors.
Microsoft Sql Server 2008 Internals Pro Developer.
Microsoft Outlook 2010 Inside Out.
Coaching Youth Volleyball 4th Edition.
Dazzling Dresses.
Sarcosuchus Imperator Discovering Dinosaurs.
Long Road To Freedom Journey Of The Hmong High Five Reading.
Clara Barton Angel Of The Battlefield.
Martin Luther King Jr Great Civil Rights Leader.
Beneath His Wings Abiding In God Apos S Comfort And Love.
How To Study Your Bible For Kids Discover 4 Yourself Inductive Bible Studies For Kids.
Overcoming Fear And Discouragement Ezra Nehemiah Esther The New Inductive Study Series.
Grandma Do You Remember When Sharing A Lifetime Of Loving Memories A Keepsake Journal.
Discover The Bible For Yourself Helpful Introductions To Every Book Practical Approaches For Stu.
Becoming The Woman Of His Dreams Seven Qualities Every Man Longs For.
Loving God With All Your Mind Growth And Study Guide Growth And Study Guides.
Breaking The Worry Habit Forever Gods Plan For Lasting Peace Of Mind.
A Marriage Without Regrets No Matter Where You Are Or Where Youve Been You Can Have.
Finding The Right One For You Secrets To Recognizing Your Perfect Mate.
Where Grace Abides The Riverhaven Years.
The Amazing Claims Of Bible Prophecy What You Need To Know In These Uncertain Times.
Sassy Single And Satisfied Secrets To Loving The Life Youre Living.
You Can Do Tea.
Quiet Time Moments For Women.
Pollution Writing The Critical Essay.
Bioisosteres In Medicinal Chemistry.
Sia.
Illustrated Classic Series Oliver Twist.
Illustrated World Classics A Connecticut Yankee In King Arthur Apos S Court.
A Manager Dna Decoded.
Proton Exchange Membrane Fuel Cells Modeling.
Love Destination Unknown.
Time And Her Little Sister.
Career And Working On Cruise.
Glimpses Of Vedic Literature 1st Edition.
Latest Shayari Sms.
Menace Of Crime In India Issues And Challenges.
Problems And Solutions In Engineering Mathematics.
Economic Liberalization Effects And Challenges 1st Edition.
Sustainability And Economic Development In Hill Agriculture.
Disaster Management And Economic Development.
Sustainable Refurbishment.
Environmental Hazards And Disasters Contexts Perspectives And Management.
Art And Architecture Of Post Gupta Period Central India.
Handbook Of Joint Disorders Arthroscopy And Pathology 1st Edition.
Numerical Techniques In C.
Learn Advanced Html 4 0 With Dhtml.
Encyclopaedia Of Plant Pathology.
Theft Of Brinjal.
Optical Imaging And Metrology.
United Nations Opposing Viewpoints.
English Language Learners Issues That Concern You.
The Loch Ness Monster Monsters.
Mount Olive.
Windows Server 2008 Administrator A.
Del Mar Fairgrounds.
Lafayette Ca Images Of America.
Indigenous Knowledge Traditions Perspective From North East India.
Optical Materials In Defence Systems Technology Iv.
Guided Meditation.
Flash Professional Cs5 Training Guide.
Imagining Alternatives.
Clean Energy Option Nuclear Safety An Indian Perspectives.
Literary Journey Of English Poetry Critical Analysis In Trends Style And Diction 2 Vols.
Practical Holography Includes Proceedings Vols 0120 1051 1212 1461 1667 1914 2176 2406 2652.
The Buffalo The Monkey.
Understanding Financial Market Its Segregation.
Modern Television Circuits Vol 10.
Spikes Of Deep Silence By Silence And In Silence.
The Goatherd And The Goats Sour Grapes.
Performance.
Encyclopedia Of World Religions 14 Vols.
Fair Trade For All How Trade Can Promote Development.
Decisions Under Uncertainty Probabilistic Analysis For Engineering Decisions.
Women Apos S Health A Complete Guide.
Snacks.
Quality Management.
Training Tact.
My Own Khajuraho.
Computer Dictionary.
Sacred Bowl.
Puzzle Pad 21.
Puzzles Pad 22.
Teaching Of Social Science For The 21st Century.
Assimilation Of Remote Sensing And In Situ Data In Modern Numerical Weather And Environmental Predic.
Fluctuations And Noise In Materials Ii.
Modern Colour Tv Circuits Vol Xviii 1st Edition.
Book 4.
Digest 5.
F1 Get The Most Out Of Excel The Ultimate Excel Tip Help Guide For All Levels Excel 97 2000 2002.
Maharana Partap.
Mughlai Dishes.
Revisiting Indian Literature.
Modern Speed Maths.
Spatial Information Technology For Natural Resource Management.
Media Literacy Project For Pre University Students.
The Bat The Dog And The Thief.
Freedom Movement In Rayalaseema A Study Of Peoples Response To The Major Phases Of National Movement.
India Apos S Policy Towards Sri Lanka Current Issues And Challenges.
Best Of Bible Stories Old Testament.
Smart Talk The Public Speakers Guide To Professional Success Unabridged Edition.
Communication Skills For Hospitality Management Objective Type Questions And Answers.
Simha The Lion.
Super Fly Guy Turtleback School Library Binding Editi.
Behold Jesus Is Coming Revelation New Inductive Study.
Ftce Math 6 12 Rea The Best Test Prep For The Florida Teacher Certification.
Manara Erotic Tarot Mini Boxed Deck Mini.
Come Out And Play.
Rainbow Pictorial Chart Book Birds.
List Of Mak And Bat Values 2004 Maximum Concentrations And Biological Tolerance Values At The Workp.
Sports Encyclopaedia.
101 Science Projects.
Cursive Writing Book Part 1.
The Da Vinci Legacy.
Ms Powerpoint 2007.
Power Inc The Epic Rivalry Between Big Business And Government And The Reckoning That Lies Ahe.
India Since Independence 2nd Edition.
Sprinting For Fitness.
Ugc Net Exam Library Information Science Multiple Choice Objective Type Quest.
Sermons On Isaiah Apos S Prophecy Of The Death And Passion Of Christ.
Education Of Children With Hearing Impairment.
The Cost Of Capital Intermediate Theory.
The Pocket Oxford Greek Dictionary.
Teaching And Assessing Skills In Computer Studies.
Advanced Accounting C A P E Ii New Syllabus.
Cities And Civilization.
Organisational Design And Development.
Adab Al Qadi Islamic Legal And Judicial System.
Etoa Munda Won The Battle A Story About Tribal Life 4th Reprint.
Thimayya An Amazing Life.
Law Of Sale Of Goods And Hire Purchase Sale Of Goods Act 1930 Hire Purchase Act 1972.
Advanced Cost And Management Accounting.
Manual On Design Of Towers For Long Span River Crossing.
America On Record A History Of Recorded Sound.
The Quality Revolution Best Practice From The World Apos S L.
Total Quality Success Through People.
Frontiers Of Ocular Pharmacology And Therapeutics.
Real Science What It Is And What It Means.
National Information System Planning And Management.
Welding Processes And Technology 2nd Edition.
Thinking The Right Way.
Saints And Their Contribution In Classical Music.
The Problem Of Linguistic Universals.
Microwave Engineering.
The Cambridge Companion To Mendelssohn.
An Ideal Personality.
Building Science And Planning.
Encyclopaedia Of Bioinformatics.
Basic Principles Of Natural And Medical Sciences In Vedas And Puranas.
Kids And Family Internet Guide.
An Introduction To The Geomorphology Of India.
Computer Aided Manufacturing In Accordance With U P Technical University Syllabus A Degree Level.
Engineering Chemistry A Textbook For First Year Engineering Students.
Wavelets And Their Applications.
Algorithms And Artificial Systems.
Epidemiology And Culture.
Vegetable Oils Sources And Enhancement Research In India.
101 Great Indian Musicians And Dancers.
Ancient Middle Niger Urbanism And The Self Organizing Landscape.
Conservation.
Introduction To The Mathematical And Statistical Foundations Of Econometrics.
Islam Its Politics And Spirituality.
Crisis Of Socialism Notes In Defence Of A Commitment.
Denial Of Justice In International Law.
Hatha Yoga For Human Health.
The Films Of Vincente Minnelli.
Competition And Monopoly In The Federal Reserve System 19141951 A Microeconomic Approach To Monet.
Allama I I Kazi His Life And Thought.
The Demography Of Victorian England And Wales.
Calculus Of Finite Differences And Numerical Analysis Allied Mathematics.
Secularism In India Theory And Practice.
Dr B R Ambedkar His Thoughts And Observations.
From Marxism To Democratic Socialism The Deeper Roots Of Affinity.
Introductory Plant Virology For Graduate And Post Graduate Students Of General Botany Microbiology.
Ngos In Livelihood Improvement Nepalese Experience.
Dictionary Of Power Systems And Electrical Engineering.
Globalisation And Sustainable Agriculture.
Methods Of Educational Research.
Waqai I Manazil I Rum Tipu Sultan Apos S Mission To Constantinople.
Monetary Economics.
Mcqs In Human Anatomy Reprint.
Liberalisation Globalisation And International Business.
Encyclopedia Of Plant Diseases In Agriculture And Horticulture.
Supervision And Safety Of Complex Systems.
Chapter Vii Trpti Dipa Prakaranam Vol 3.
The Arena Man.
Junior Encyclopedia Human Body Question Answers Book.
The Edge 50 Tips From Brands That Lead.
Retailing In India Emerging Trends.
Prophet Of Bones A Novel Unabridged Edition.
Managing And Measuring Patients Satisfaction 1st Edition.
Ugc Net Digest On Paper Ii Iii Physical Education.
Women Apos S Social Rights And Entitlements.
The Planting Of Christianity In Africa Vol Ii To 1840.
The Avram Davidson Treasury A Tribute Collection.
A Glimpse At The Back Of The Book A Commentary On The Book Of Revelation.
Farmer Duck.
Ocean Waves A Quilting Mystery.
Field Guide To The Little People A Curious Journey Into The Hidden Realm Of Elves Faeries Hobgobl.
Letting The Light In Transforming Your Pain Into Power.
My Listography My Amazing Life In Lists.
Stencil 101 Make Your Mark With 25 Reusable Stencils And Step By Step Instructions.
Tequila Myth Magic Am.
Life In Color Visual Therapy Apos S Guide To The Perfect Palettefor Your Clo.
In My Nest Finger Puppet Book.
Porch Parties Cocktail Recipes Easy Ideas For Outdoor Entertaining.
Fresh From The Farmers Market Reissue Year Round Recipes For The Pick Of The Crop.
Farts A Spotter Apos S Guide.
The Doorbells Of Florence Fictional Stories And Photographs.
The Country Cooking Of Ireland.
Polk County Georgia Ga Images Of America.
Design Research The Store That Brought Modern Living To American Homes.
Bound To Be Bad Ivy And Bean Book 5.
New York City Subway.
Talking To Tweens Getting It Right Before It Gets Rocky With Your 8 To 12 Year Old.
Chocolate Cakes 50 Great Cakes For Every Occasion.
Young Guns 6 And The Undiscovered Letter Vol 1.
Fuck You And Your Blog Journal.
Philadelphia Graveyards And Cemeteries Images Of America Pennsylvania.
Kitchen Sticky Notes Helpful Notes For The Home Cook.
The Little Books Boxed Set.
Mini Locker Notes.
1 001 Ways To Live In The Moment.
Eat Ate.
Scribble It 30 Postcards.
Cupcake Shoppe Stationery.
Moma Modern Play Family.
Let Apos S Bring Back.
A Long Piece Of String.
Stories For Bedtime A Keepsake Pocket And Tales To Cherish.
You Can Do It Too.
In My Forest.
The Worst Case Scenario Survival Handbook Gross Junior Edition.
Giant Pop Out Safari A Pop Out Surprise Book.
Touch The Five Senses.
Language In The Inner City Studies In The Black English Vernacular Conduct And Communication.
Daily Life In The World Of Charlemagne Middle Ages.
Everyday Life In Egypt In The Days Of Ramesses The Great.
The Spoken Word And The Work Of Interpretation Conduct And Communication.
History Begins At Sumer Thirty Nine Firsts In Recorded History 3rd Edition.
Enterprising Women Television Fandom And The Creation Of Popular Myth.
Dangerous Men And Adventurous Women Romance Writers On The Appeal Of The Romance.
Before Columbus Exploration And Colonization From The Mediterranean To The Atlantic 1229 1492.
Aquinas And The Jews.
Beyond The Red Notebook Essays On Paul Auster Penn Studies In Contemporary American Fiction.
The Heartland Chronicles.
Indian Literature In English Translation.
Phycology Nature And Nuriture.
History Of Journalism.
Jammu And Kashmir Charting A Future.
Defence Policy Of India Nehru To Manmohan.
Birds Of Himalaya And Kashmir.
Strategies For Performance Management.
Street Children And The Child Labour.
Problems Of Slums And Viable Strategies For Development.
Social Cognition And Communalism.
Introductory Quantum Mechanics And Spectroscopy.
Dynamics Of Creativity And Interests Engineers Verses Civil Servants.
Solution To Problems Financial Accounting Hp.
Economics Of Asymmetric Information.
Modern Women And The Society.
Management Of Health Education Programme.
Camping Management In Physical Education.
Record Of Yoga.
Language In Contemporary India.
Ugc Net Manual For Library And Information Science Paper Ii Objective Questions And Paper Iii D.
Vitality Of East Asian Christianity Challenges To Mission And Theology In Japan.
Ddc 22 A Practical Approach.
Concept Of Suffering In Buddhism 1st Published.
Citriculture.
Introduction To Operating System.
Elementary Income Tax Ap.
Education On Internet Programming.
Introduction To Chemical Equipment Design Mechanical Aspects.
Environment And Pollution Education.
Human Resource Development Theory And Practice.
Epicentre Of Violence Partition Voices And Memories From Amritsar.
Rasa Jala Nidhi Or Ocean Of Indian Chemistry And Alchemy With English Translation.
Philosophical Reflections Essays On Socio Ethical Philosophy And Philosophy Of Religion.
Intimacy.
A Textbook Of Windows Based Computer Courses.
Guide For Employees To Rise In Service.
Boy.
Dyes And Pigments 1st Edition.
2012 Extinction Or Utopia Doomsday Prophecies Explored.
Instruments Of Darkness Witchcraft In Early Modern England.
Other Middle Ages Witnesses At The Margins Of Medieval Society The Middle Ages Series.
Maurice Apos S Strategikon Handbook Of Byzantine.
In The Days Of Serfdom And Other Stories.
The Battle Of El Alamein Fortress In The Sand.
The Medieval Craft Of Memory An Anthology Of Texts And Pictures.
The Arrow Of Gold A Story Between Two Notes.
Youthscapes The Popular The National The Global.
Animals For Show And Pleasure In Ancient Rome.
On Risk And Disaster Lessons From Hurricane Katrina.
Peace And Freedom The Civil Rights And Antiwar Movements In The 1960s.
Creating East And West Renaissance Humanists And The Ottoman Turks.
History Matters Patriarchy And The Challenge Of Feminism.
The Digest Of Justinian Vol 3 Revised Edition.
The Art Of Being Jewish In Modern Times Jewish Culture And Contexts.
Gothic Bodies The Politics Of Pain In Romantic Fiction.
In The Blood Sickle Cell Anemia And The Politics Of Race.
The History Of The Counts Of Guines And Lords Of Ardres The Middle Ages Series.
Hastening Toward Prague Power And Society In The Medieval Czech Lands.
Human Rights Under African Constitutions Realizing The Promise For Ourselves Pennsylvania Studies.
Understanding Terror Networks.
1 001 Pearls Of Bible Wisdom.
All Cakes Considered A Years Worth Of Weekly Recipes Tested Tasted And Approved By The Staff Of Np.
The Story Of Snow The Science Of Winter Apos S Wonder.
Stonewall Kitchen Appetizers Finger Foods And Small Plates.
Southern Pies A Gracious Plenty Of Pie Recipes From Lemon Chess To Chocolate Pecan.
Taro Gomi Apos S Play All Day More Than 100 Punch Out Pieces.
642 Things To Draw Journal.
Hop To It A Guide To Training Your Pet Rabbit Pet Series Training.
Legal Research For Beginners.
Terror Red.
English On The Go Travel Health Business.
Publishing And Presenting Clinical Research 3rd Edition.
Orality The Power Of The Spoken Word.
Children Illustrated Encyclopedia.
Queer Love In Film And Television Critical Essays.
Monthly Digest Of Statistics Vol 719 November 2005.
The Letter Of Violence Essays On Narrative Ethics And Politics.
Wisely Stupid.
Know About Communication.
The Pink Hotel A Novel.
Doing Business In India.
Fanshawe College.
Swine Nutrition.
Let Apos S Read Jack And The Beanstalk Level 3.
Abc Murders Abridged Edition.
Remapping India New States And Their Political Origins.
Grammar Can Be Fun 1.
Out Of Many A History Of The America Pepole.
Memoirs Of The Life Of Colonel Hutchinson Charles I S Puritan.
Technology Of Instructional Design Part I.
Speaking Of Child Care And Nutrition A Practical Guide The Others Useful Insights Into The Physical.
Human Rights A Gandhian Perspective.
Titans Of Indian Politics Biographical Encyclopaedia Of Great Indians Vol Xi Part Ii.
Dimensions Of Comparative Politics.
Business Communication Jammu.
Business Communication Gauhati.
Indian Writings In English.
Cost Accounting Jammu.
Industrial Law An Encyclopaedia Of All Central Labour Acts With States Amendments Rules Regulati.
Hotel And Hospitality Management Housekeeping.
Statistical Models In Earth Sciences.
Management And Cultural Values The Indigenization Of Organisations In Asia.
Rural Non Farm Growth Sign Of Farm Success Or Failure.
Jewellery Of Scripture.
Lord Jagannatha In Sanskrit Literature.
Heidegger And The Thinking Of Place Explorations In The Topology Of Being.
King Of The Cowboys The Life And Times Of Jerry Jones.
Xenophobia And Islamophobia In Europe 1st Edition.
Another Fine Dress Role Play In The Films Of Laurel And Hardy.
Virginia Woolf The Common Ground 1st Edition.
Pursuit 2nd Edition.
The Global Community Yearbook Of International Law And Jurisprudence 2009.
Physiological Animal Ecology.
Oman Culture And Diplomacy 1st Edition.
Transmission Toward A Post Television Culture.
Noddy Looks For Treasure.
The Executive Apos S Guide To Financial Manageme.
Gwen 10.
The Edinburgh Companion To Scottish Women Apos S Writing 1st Edition.
No More Nice Girl Power Sexuality And Success In The Workplace 1st Edition.
The Concise Dictionary Of Construction.
Foucault Apos S History Of Sexuality Vol I The Will To Knowledge Vol 1 An Edinburgh Phil.
The Hojjatiyeh Society In Iran Ideology And Practice From The 1950s To The Present.
Deleuze And The Transcendental Conditions Of Thought.
Indian Rebellion.
Virginia Woolf Apos S Essayism 1st Edition.
Whirlwind 1st Edition.
Geospatial Technologies For Natural Resources Management.
Death Is That Man Taking Names Intersections Of American Medicine Law And Culture.
Sustainability If It Apos S Everything Is It Nothing.
Monkey Beach 1st Edition.
Current Economic Issues In Eu Integration.
Questions Answers In Medicine For M D.
Lexicon Word Book To The Mind Section Of The Repertory.
Mentally Retarded Children And Behaviour Problem Its Modification With Homoeopathic Medicine.
Efficiency And Governance.
The Devouring Dragon How China Apos S Rise Threatens Our Natural Wor.
De Fiore S Atlas Of Histology 7th Edition.
Culture And Aesthetics Of Druga In Nepalamandala.
How To Pass Your Motorcycle Test First Time 1st Edtion.
Introduction To Exercise Physiology.
Rosaline I Love You But Dont Tell Your Dad.
Memory Bank For Chemotherapy.
Understanding Human Behaviour In Health And Illness 3rd.
Green.
Doras Camping Trip.
Tormented By History Nationalism In Greece And Turkey.
Pornography Sexual Representation Vol 11 A Reference Guide 1st Edition.
Communion A True Story 1st Edition.
The Collection Program In Schools Concepts Practices And Information Sources 3rd Edition.
The Evaluation And Treatment Of The Patient With Diarrhea 1st Edition.
Neurovascular Surgical Techniques 1st Edition.
Collection Development Its Organization And Services In University Libraries.
Dynamic Supply Chain Alignment Indian Reprint.
Mcqs In Midwifery And Obstetrical Nursing As Per The Syllabus Of Indian Nursing Council Inc 1st Ed.
Postmenopausal Osteoporosis Basic And Clinical Concepts 1st Edition.
Hernia Surgery Simplified 1st Edition.
A Cluster Of Perspectives Vol 3 Taken From The Author Apos S Notebooks.
Dnb Quick Review 1st Edition.
Atlas Of Pediatric Infectious Diseases 1st Edition.
Guide To Bank Audit 2nd Edition.
Automation And Digitization Of University Libraries Status Prospects And Problems 1st Edition.
Ophthalmic Assistant 1st Edition.
Cabinet Secretariat Exam Guide Tier I.
Succinct Concise Anatomy For Dental Students With Mcqs For Bds 1st Year 1st Edition.
The Geneva Trap A Liz Carlyle Novel 1st Edition.
Contracts For The International Sale Of Goods Applicability And Applications Of The 1980 United Nat.
Special Flavours Of Europe And The Orient Fine Dining In Diplomatic Enclaves.
Reflections The Bollywood Connection 1st Edition.
How To Speak And Write Correctly.
Techniques Of Teaching Social Science.
Adventures In Central Asia A Hungarian In The Great Game 1st Published.
Handbook Of Pharmaceutical Biotechnology 1st Edition.

Page:1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155 156 157 158 159 160 161 162 163 164 165 166 167 168 169 170 171 172 173 174 175 176 177 178 179 180 181 182 183 184 185 186 187 188 189 190 191 192 193 194 195 196 197 198 199 200 201 202 203 204 205 206 207 208 209 210 211 212 213 214 215 216 217 218 219 220 221 222 223 224 225 226 227 228 229 230 231 232 233 234 235 236 237 238 239 240 241 242 243 244 245 246 247 248 249 250 251 252 253 254 255 256 257 258 259 260 261 262 263 264 265 266 267 268 269 270 271 272 273 274 275 276 277 278 279 280 281 282 283 284 285 286 287 288 289 290 291 292 293 294 295 296 297 298 299 300 301 302 303 304 305 306 307 308 309 310 311 312 313 314 315 316 317 318 319 320 321 322 323 324 325 326 327 328 329 330 331 332 333 334 335 336 337 338 339 340 341 342 343 344 345 346 347 348 349 350 351 352 353 354 355 356 357 358 359 360 361 362 363 364 365 366 367 368 369 370 371 372 373 374 375 376 377 378 379 380 381 382 383 384 385 386 387 388 389 390 391 392 393 394 395 396 397 398 399 400 401 402 403 404 405 406 407 408 409 410 411 412 413 414 415 416 417 418 419 420 421 422 423 424 425 426 427 428 429


Design copyright © 2019 bangoseguros.es||Contact||Sitemap